SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005504 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005504
Domain Number 1 Region: 647-828
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.89e-41
Family Ypt/Rab-GAP domain of gyp1p 0.0053
Further Details:      
 
Domain Number 2 Region: 803-924
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.46e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0041
Further Details:      
 
Domain Number 3 Region: 10-40,131-260
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-28
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000005504
Domain Number - Region: 255-316
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0497
Family Recombination protein RecR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005504   Gene: ENSPANG00000006285   Transcript: ENSPANT00000026267
Sequence length 1054
Comment pep:known_by_projection chromosome:PapAnu2.0:17:52969786:53047723:-1 gene:ENSPANG00000006285 transcript:ENSPANT00000026267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEDAKPSKDNEDAFYNSQKFEVLYCGKVTVTHKKAPSSLIDDCMEKFSLHEQQRLKIQG
EQRSVDPGEDLADLEVVVPGSPGDCLPEEADGTDTHLGLPAVASQPALSSSRVCFPERIL
EDSGFDEQQEFRSRCSSVTGVQRRVHEGSQKSQPRRRHASAPSHVQPSDSEKNRTMLFQV
GRFEINLISPDTKSVVLEKNFKDISSCSQGIKHVDHFGFICRESPEPGLSQYICYVFQCA
SESLVDEVMLTLKQAFSTAAALQSAKTQIKLCEACPMHSLHKLCERIEGLYPPRAKLVIQ
RHLSSLTDNEQADIFERVQKMKPASDQEENELVILHLRQMCEAKQKTHVHIGEGPSTISN
STIPENATSSGRFKLDILKNKAKRSLTSSLENIFSRGANRMRGRLGSVDSFERSNSLASE
KDYSPGDSPPGTPPASPLSSAWQTFPEEDSDSPQFRRRAHTFSHPPSSTKRKLNLQDGRA
QGVRSPLLRQSSSEQCSDGEGRKRTSSTCSNESLSVGGTSVTPRRISWRQRIFLRVASPM
NKSPSAMQQQDGLDRNELLPLSPLSPTMEEEPLVIFLSGEDDPEKIEERKKSKELRSLWR
KAIHQQILLLRMEKENQKLEASRDELQSRKVKLDYEEVGACQKEVLITWDKKLLNCRAKI
RCDMEDIHTLLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQPPDISYKELLKQLTAQQH
AILVDLGRTFPTHPYFSVQLGPGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLLLHMSE
EQAFEMLKFLMYDLGFRKQYRPDMMSLQIEMYQLSRLLHDYHRDLYNHLEENEISPSLYA
APWFLTLFASQFSLGFVARVFDIIFLQGTEVIFKVALSLLSSQETLIMECESFENIVEFL
KSTLPDMNTSEMEKIITQVFEMDISKQLHAYEVEYHVLQDELQESSYACEDSEPLEKLER
ANSQLKRQNMDLLEKLQVAHAKIQALESNLENILTRETKMKSLIRTLEQEKMAYQKTVEQ
IRKLLPADALANCELLLRDLSCNPNNKAKIGSKP
Download sequence
Identical sequences ENSPANP00000005504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]