SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005516 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005516
Domain Number 1 Region: 1022-1137
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.97e-20
Family Regulator of G-protein signaling, RGS 0.0026
Further Details:      
 
Domain Number 2 Region: 850-978
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.42e-19
Family Regulator of G-protein signaling, RGS 0.0066
Further Details:      
 
Domain Number 3 Region: 659-782
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.24e-18
Family Regulator of G-protein signaling, RGS 0.003
Further Details:      
 
Domain Number 4 Region: 411-513
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000025
Family Regulator of G-protein signaling, RGS 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005516   Gene: ENSPANG00000006695   Transcript: ENSPANT00000019664
Sequence length 1265
Comment pep:known_by_projection chromosome:PapAnu2.0:8:95232377:95385894:-1 gene:ENSPANG00000006695 transcript:ENSPANT00000019664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVKRLTAEPPAITEEEFEDSLATDDFLVDYFNEFLSLPTFSEAIRFNADYGVFEVVNDA
PQLLEKQLKKILQNQQPRNPIFDVVRKGKNEVKPVQMNASEENETINVNYNIMCLSREEG
IKWIKKKRLPAFLESDCYFEYRLAKLVSQVRWSKSGMNFTVESNFSPWIVKKPPSLPPPA
TEEDNLVIMKKFYVSLGEASYAQTKDWFALAKQSQQTVSTFSLPCCVPYNKLKSPAISSV
SENFIFDDGVHPRTKKDPFKTTKLISEFEEEEGEEEEEVSVSLQDTPSQALLRVYLEKKQ
DVGESLTMHFSTCEEFVSSYVYFILRGAIQQIVGKPVGETPDYINFNNITKVSFDDCFES
IRGKNFLSELVQTTKERSEEIEQTSLSSKSESAGPESRADWCISHRTYDIGNRKEFERFK
KFIKGTLGERYWWLWMDIERLKVLKDHGRHQRHVEKMKKCYLVSNGDYYLSAEILSKFKL
LDGSQWNEEHLRNIQPEVLKPLLLYWAPRFCVTHSPSTKYASAELKFWHLRQAKPRKDID
PFPQMATLLPLRPKSCIPQIPEIQKEEFSLSQPPKSSNKSPGVKSATQKPWKSALLYPDS
SKDHVIEKGSKHVSESSNVIHLTSFTDISECLKPQLDRRYAYTEEPKVKTVSDVGALGGF
DMENLLQSLYVENRAGFFFTKFCEHSGNKLWKNSVYFWFDLQAYHQLFYQETLQPFKVCK
QAQYLFATYVAPSATLDIGLQQEKKKEIYMKIQPPFEDLFDTAEEYILLLLLEPWTKMVK
SDQIAYKKVELVEETRQLDSTYFRKLQALHKETLSKKAGDTTCEIGSGILSLSNVSKRTE
YWDNVPAEYKHFKFSDLLNNKLEFEHFRQFLETHSSSMDLMCWTDIEQLRRITYRDRNQR
EAKSIYIKNKYLNKKYFFGPNSPASLYQQNQVMHLSGGWGKILHEQLDAPVLVEIQKHVQ
NRLENVWLPLFLASEQFAARQKIKVQMEDIAEELLLQKPEKKIGVWKPVESKWISSSCEI
IAFRKALLNPVTSRQFQRFVALKGDLLENGLLFWQEVQKYKDLCHSHCDESVIQKKITTI
INCFINSSIPPALQIDIPVEQAQKIIEHRKELGPYVFREAQMTIFGVLFKFWPQFCEFRK
NLTDENIMSVLERRQEYNKQKKKLAVLEDEKSGKDGIKQYANTSVPAIKTALLSDSFLGL
QPYGRQPTWCYSKYIEALEQERILLKIQEELEKKLFAGLQPLTNFKASASTMSLKKNMSA
HSSQK
Download sequence
Identical sequences A0A096MZV9
ENSPANP00000005516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]