SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005527 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005527
Domain Number 1 Region: 15-276
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.43e-81
Family Eukaryotic proteases 0.0000000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005527   Gene: ENSPANG00000025441   Transcript: ENSPANT00000028866
Sequence length 277
Comment pep:novel chromosome:PapAnu2.0:1:17870154:17878411:1 gene:ENSPANG00000025441 transcript:ENSPANT00000028866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSASPEHPTTLGITVLAALLACASSCGVPSFPPSLSARVVGGETARPHSWPWQISLQYLE
NNRWWHTCGGILIARNFVLTAAHCISNNRIYRVALGKHNLEVEDEEGSLIVDVDTIYVHE
KWISLLVLNDIALIKLAEHVELSDTIQVACLPEKDSLLPNDYPCYVTGWGRLWTNGPIAD
ELQQGLQRVVDHATCSRIDWWGFMVTETMVCAGGDGIISAYSGDSGGPLNCQLENGSWEV
FGIVSFGSPWGYNTFKKPVVYARVSAYIDWINEKMQL
Download sequence
Identical sequences ENSPANP00000005527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]