SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005560 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005560
Domain Number 1 Region: 316-397
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 9.67e-25
Family PHD domain 0.0000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005560   Gene: ENSPANG00000015880   Transcript: ENSPANT00000009706
Sequence length 419
Comment pep:known_by_projection chromosome:PapAnu2.0:17:87716634:87721085:1 gene:ENSPANG00000015880 transcript:ENSPANT00000009706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSFVECPYDSPAERLVAEADEGGCSAITGMGLCFRCLLFSFSGRSGVEVDLNVFGSLGLQ
PRIGPCRCWGGLCSSALRCGWFSSWPPPSKSAIPICGGSRGARRVSRWPPPHWLEGRLVS
PRPLSPLSTATFGRGAMAVAGTPGLGARGRGCSSGRLPRPARPACRQSQAASLLTRGRGR
AWPGKQILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVE
NRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAAQAEKPNSKRSRRQRNNENRE
NASSNHDHEDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSY
GEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR
Download sequence
Identical sequences ENSPANP00000005560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]