SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005573 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005573
Domain Number 1 Region: 8-169
Classification Level Classification E-value
Superfamily EF-hand 7.69e-49
Family Calmodulin-like 0.00000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005573   Gene: ENSPANG00000003450   Transcript: ENSPANT00000002994
Sequence length 172
Comment pep:known_by_projection chromosome:PapAnu2.0:18:12612223:12612738:-1 gene:ENSPANG00000003450 transcript:ENSPANT00000002994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSFKKPSAAPTSQKRKVAPKPELTEDQKQEVREAFDLFDADGSGTIDVKELKVAMRAL
GFEPRKEEMKKMISEVDKEGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGK
ISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTNLY
Download sequence
Identical sequences A0A096N013 A0A2K5KWD4 A0A2K5XR76
ENSPANP00000005573 XP_011851732.1.47321 XP_011911579.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]