SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005591 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005591
Domain Number 1 Region: 167-496
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 5.7e-111
Family Protein serine/threonine phosphatase 0.0000000000177
Further Details:      
 
Domain Number 2 Region: 26-155
Classification Level Classification E-value
Superfamily TPR-like 3.25e-32
Family Tetratricopeptide repeat (TPR) 0.000000312
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005591   Gene: ENSPANG00000002966   Transcript: ENSPANT00000008841
Sequence length 499
Comment pep:known_by_projection chromosome:PapAnu2.0:19:39660949:39702000:1 gene:ENSPANG00000002966 transcript:ENSPANT00000008841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMAEGERTECAEPPRDEHPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPS
NAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYE
TVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPK
LEDGKVTITFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVC
GDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLL
RGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDG
VTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSVSKRGVSCQFGPDVTKAFLEENNL
DYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVP
HPNVKPMAYANTLLQLGMM
Download sequence
Identical sequences A0A0A0MV89 A0A0D9S291 A0A2K5LPV9 A0A2K6AIH6 F6XI05 G7PXY4
9544.ENSMMUP00000000309 ENSPANP00000005591 NP_001253015.1.72884 XP_007995484.1.81039 XP_011824851.1.47321 XP_011935999.1.92194 ENSMMUP00000000308 ENSMMUP00000000309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]