SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005596 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005596
Domain Number 1 Region: 198-388
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.62e-27
Family SPRY domain 0.02
Further Details:      
 
Domain Number 2 Region: 420-570
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000117
Family Nucleotide and nucleoside kinases 0.031
Further Details:      
 
Domain Number 3 Region: 2-39
Classification Level Classification E-value
Superfamily SAP domain 0.0000000604
Family SAP domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005596   Gene: ENSPANG00000023745   Transcript: ENSPANT00000012782
Sequence length 714
Comment pep:novel chromosome:PapAnu2.0:14:11003905:11017107:1 gene:ENSPANG00000023745 transcript:ENSPANT00000012782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVKRLKVTELRSELQRRGLDSRGLKVDLAQRLQEALDAEMLEDACKAEPRPVAASGGGP
GAPPTQALGQAAQPPPEPPEAAAMEAAAEPDASEKPVETTVGSGGVNGGEEQGPGKGEED
EPEERSGDETPGSEVPGDKAAEEQGDDQDSEKSKPAGSDGERRGVKRQRDEKDEHGRAYY
EFREEAYHSRYSSKSPLPPEEEAKDEEEDQTLVNLDTYTSDLHFQVSKDRYGGQPLFSEK
FPTLWSGARSTYGVTKGKVCFEAKVTQNLPMKEGCTEVSLLRVGWSVDFSRPQLGEDEFS
YGFDGRGLKAENGQFEEFGQTFGENDVIGCFANFETEEVELSFSKNGEDLGVAFWINKES
LADRALLPHVLCKNCVVELNFGQKEEPFFPPPEEFVFIHAVPVEERVRTAVPPKTIEECE
VILMVGLPGSGKTQWALKYAKENPEKRYNVLGAETVLNQMRMKGLEEPEMDPKSRDLLVQ
QASQCLSKLVQIASRTKRNFILDQCNVYNSGQRRKLLLFKTFSRKVVVVVPNEEDWKKRL
ELRKEVEGDDVPESIMLEMKANFSLPEKCDYMDEVTYGELEKEEAQPIVTKYKEEARKLL
PPSEKRTNRRNNRNKRNRQNRSRGQGYVGGQRRGYDNRAYGQQYWGQPGNRGGYRNFYDR
YRGDYDRFYGRDYEYNRYRDYYRQYNRDWQSYYYHHPQDRDRYYRNYYGYQGYR
Download sequence
Identical sequences ENSPANP00000005596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]