SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005617 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005617
Domain Number 1 Region: 215-392
Classification Level Classification E-value
Superfamily MIR domain 8.76e-47
Family MIR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 1079-1206
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-18
Family SPRY domain 0.039
Further Details:      
 
Domain Number 3 Region: 659-794
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000253
Family SPRY domain 0.064
Further Details:      
 
Domain Number 4 Region: 1432-1556
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000633
Family SPRY domain 0.04
Further Details:      
 
Domain Number 5 Region: 437-550
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000745
Family IP3 receptor type 1 binding core, domain 2 0.012
Further Details:      
 
Domain Number 6 Region: 2186-2256
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000123
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Domain Number 7 Region: 4055-4133
Classification Level Classification E-value
Superfamily EF-hand 0.0000149
Family Calmodulin-like 0.051
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000005617
Domain Number - Region: 101-185
Classification Level Classification E-value
Superfamily MIR domain 0.000131
Family MIR domain 0.028
Further Details:      
 
Domain Number - Region: 2218-2252,2542-2619,2906-3074,3131-3203
Classification Level Classification E-value
Superfamily ARM repeat 0.0374
Family Pumilio repeat 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005617   Gene: ENSPANG00000020887   Transcript: ENSPANT00000017004
Sequence length 4945
Comment pep:known_by_projection chromosome:PapAnu2.0:19:32699970:32857343:1 gene:ENSPANG00000020887 transcript:ENSPANT00000017004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADAEGEDDVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPD
LAICCFVLEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLSCL
TTSRSMTDKLAFDVGLQEDAIGEACWWTTHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQ
RRLVYYEGGAVCTHARSLWRLEPLRISWSGSHLRWGQPLRVRHVTTGRYLALTEDQGLVV
VDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSF
SGKPRGSGPPAGTALPIEGVILSLQDLIIYFEPPSEDLQHEEKQSKLRSLRNRQSLFQEE
GMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLD
VLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGTTQYSK
WYFEVMVDEVTPFLTAQATHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVVSCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVV
SFSAGVKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLEPIKEYRREGPRGPHLVG
PSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMM
SNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVGQGWSYSAVQDIPARRNPRL
VPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRWDRVRIFRAEKSY
AVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGR
PWQPGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFREIEIGDGFLPVCSLGPGQVGH
LNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLPQFEPVPLEHPHYEVARVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAED
EARAAEPDPDYENLRRSAGGWGEAENGKEGTAKEGAPGGTPQAGGEAQPARAENEKDATT
EKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFA
GQEPSCVWVGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNIHSSLKCSNCYMVWGGDFV
SPGQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQNV
IQFELGKQKNIMPLSAAMFQSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQVETRRAG
ERLGWAVQCREPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNRV
AHALCSHVDQAQLLHALEDAHLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLTPE
TRAITLFPPGRSTENGHPRHGLPGVGVSTSLRPPHHFSAPCFVAALPAAGAAEAPARLSP
AIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMASSCFPLSR
SSSTFPKLQKYMHQSCSIYASNHPFLPSSMHPSIHLSMYPSTISLSFIHLSLHLLTCYLF
MFIHLFFLPIHLSNQPSFIHASIHRYSTRLSIHPFILSIHVYRSSFHQQVHLPFYPFLLH
HSIHSFMYPSIQVSIYLPIHLFIHSYSSPSTINEYMNKDMNIQRSKLLDHFQEFSWTGEE
EEPEEETTLGSRLMSLLEKVRLVKKKEEKPEEERPAEESKPRSLQELVSHMVVRWAQEDF
VQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECLGQIRSLLIVQM
GPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMVT
SCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALAL
QEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDFLRFAVFVNGESVEENA
NVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGIRRDRRREHFGEEP
PEENRVHLGHAIMSFYAALIDLLGRCAPEMHLIQACKGEALRIRAILRSLVPLEDLVGII
SLPLQMPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLHVLDVGFLPDM
RAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLS
RGRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYER
CWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAMPCLCAIAGAL
PPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDK
IQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKAREGE
EEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSAVTLSRELQAMAEQLAENYHNTWGRKK
KQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTSSLHISRGLKDM
ELDSSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLP
LINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTDAPAV
VNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKG
VGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTKNIYVE
KLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMCPDIP
VLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPPALPAGAPPPC
TAVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLQSHFIPTIGR
LRKRAGKVVSEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIRYVDNNRAQWL
TEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKAGDT
QSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLITLAKTRYALKD
TDEEVREFLNNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLY
YLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAAWILT
EDHSFEDRMIDDLSKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMA
YADIMAKSCHLEEGGENGEGEEEVEVSFEEKEMEKQRLLYQQARLHTRGAAEMVLQMISA
CKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLN
AFERQNKAEGLGMVNEDGTVLLAAPVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNNDF
QNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAK
QVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDL
QKDMVVMLLSLLEGNVVNGTIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEAFQD
YVTDPRGLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARDI
GFNVAVLLTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISE
TNRAQWEMPQVKESKRQFIFDVVNEGGEAEKMELFVSFCEDTIFEMQIAAQISEPEGEPE
TALRGLSYRSLLWAALVEGAKKVTVTELLAGMPDPTSDEVHGEQPAGPGGDADGEGASEG
AGDAAEGAGDEEEAVDEAGPGGADGAVAVTDGGPFRPEGAGGLGDMGDTTPAEPPTPEGS
PILKRKLGVDGVEEELPPEPEPEPELEPEKADAENGEKEEVPEPPPEPPKKQAPPSPPPK
KEEAGGEFWGELEVQRVKFLNYLSRNFYTLRFLALFLAFAINFILLFYKVSDSPPGEDDM
EGSAAGDVSGAGSGGGSGWGLGAGEEAEGDEDENMVYYFLEESTGYMEPALRCLSLLHTL
VAFLCIIGYNCLKVPLVIFKREKELARKLEFDGLYITEQPEDDDVKGQWDRLVLNTPSFP
SNYWDKFVKRKVLDKHGDIYGRERIAELLGMDLATLEITAHNERKPDPPPGLLTWLMSID
VKYQIWKFGVIFTDNSFLYLGWYMVMSLLGHYNNFFFAAHLLDIAMGVKTLRTILSSVTH
NGKQLVMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVR
AGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKE
DMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWK
MYQERCWDFFPAGDCFRKQYEDQLS
Download sequence
Identical sequences ENSPANP00000005617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]