SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005618 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005618
Domain Number 1 Region: 342-406
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.76e-18
Family PHD domain 0.0055
Further Details:      
 
Domain Number 2 Region: 218-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000175
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 3 Region: 296-353
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000048
Family PHD domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005618   Gene: ENSPANG00000014112   Transcript: ENSPANT00000001919
Sequence length 414
Comment pep:known_by_projection chromosome:PapAnu2.0:19:32470359:32483631:-1 gene:ENSPANG00000014112 transcript:ENSPANT00000001919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGLSARPTAGRTDPAGTCWGQDPGSKMATVIPGPLSLGEDFYREAIEHCRSYNARLCAE
RSLRLPFLDSQTGVAQNNCYIWMEKTHRGPGLAPGQIYTYPARCWRKKRRLNILEDPRLR
PCEYKIDCEAPLKKEGGLPEGPVLEALLCAETGEKKIELKEEETIMDCQKQQLLEFPHDL
EVEDLEDDIPRRKNRAKGKAYGIGGLRKRQDTASLEDRDKPYVCDICGKRYKNRPGLSYH
YTHTHLAEEEGEENAERHALPFHRKNNHKQFYKELAWVPEAQRKHTAKKAPDGTVIPNGY
CDFCLGGSKKTGCPEDLISCADCGRSGHPSCLQFTVNMTAAVRTYRWQCIECKSCSLCGT
SENDDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLCLRHLKEKASAYITLT
Download sequence
Identical sequences A0A2J8QEX0 A0A2K6DUM2 H2NYN0 I2CUS6 U3EED3
NP_001128627.1.87134 NP_001128627.1.92137 XP_003796183.1.62490 XP_005589130.1.63531 XP_007994841.1.81039 XP_011763212.1.29376 XP_011934501.1.92194 XP_012291836.1.9421 XP_012630217.1.48125 XP_014979319.1.72884 XP_016791329.1.37143 XP_017362105.1.71028 ENSP00000347716 ENSPPYP00000011112 ENSP00000412098 ENSP00000347716 gi|205830430|ref|NP_001128627.1| ENSPANP00000005618 9606.ENSP00000394981 ENSPPYP00000011112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]