SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005625 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005625
Domain Number 1 Region: 724-939
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.39e-105
Family Thrombospondin C-terminal domain 0.0000000869
Further Details:      
 
Domain Number 2 Region: 597-722
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.57e-34
Family TSP type-3 repeat 0.00000396
Further Details:      
 
Domain Number 3 Region: 516-599
Classification Level Classification E-value
Superfamily TSP type-3 repeat 3.14e-19
Family TSP type-3 repeat 0.0000667
Further Details:      
 
Domain Number 4 Region: 225-270
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.00000000000000109
Family Assembly domain of cartilage oligomeric matrix protein 0.002
Further Details:      
 
Domain Number 5 Region: 445-540
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000798
Family TSP type-3 repeat 0.00016
Further Details:      
 
Domain Number 6 Region: 53-151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000135
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 7 Region: 316-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000015
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000005625
Domain Number - Region: 363-408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00165
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 278-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 416-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0838
Family EGF-type module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005625   Gene: ENSPANG00000009078   Transcript: ENSPANT00000019500
Sequence length 956
Comment pep:known_by_projection chromosome:PapAnu2.0:1:129019184:129034042:-1 gene:ENSPANG00000009078 transcript:ENSPANT00000019500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQELRGALALLLLCSFASASQDLQVIDLLTVGESRQMVAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTVLLRLRGPSRPSPALHLYVDCKLGDQHAGLPALAPIPPAEVDGLEIRTGQKAYLRM
QGFVESMKIILGGSMARVGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCSDINECVHADPCFPGSSCINTMPGFHCEACPRGYKGTQVSGVGIDY
ARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCLPARTCHS
PAHSPCHIHAHCLFERNGAVSCQCNVGWAGNGNVCGTDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDVDSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSG
PGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
Download sequence
Identical sequences A0A096N055 A0A2K5MVX6 A0A2K5YAW4
XP_007975059.1.81039 XP_011842868.1.47321 XP_011932212.1.92194 ENSPANP00000005625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]