SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005626 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005626
Domain Number 1 Region: 17-135
Classification Level Classification E-value
Superfamily Cupredoxins 9.73e-37
Family Ephrin ectodomain 0.0000538
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005626   Gene: ENSPANG00000018153   Transcript: ENSPANT00000026284
Sequence length 146
Comment pep:known_by_projection chromosome:PapAnu2.0:1:128886983:128891347:1 gene:ENSPANG00000018153 transcript:ENSPANT00000026284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWCPPLLSPPLSYACRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWP
GYESCQAEGPRAFKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESS
GQCLRLQVSVCCKERSKWVGGMDPTG
Download sequence
Identical sequences ENSPANP00000005626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]