SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005632 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005632
Domain Number 1 Region: 60-352,461-500
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.38e-55
Family FAD-linked reductases, N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 333-450
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.55e-27
Family L-aminoacid/polyamine oxidase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005632   Gene: ENSPANG00000023559   Transcript: ENSPANT00000015203
Sequence length 514
Comment pep:novel chromosome:PapAnu2.0:1:45284809:45292012:-1 gene:ENSPANG00000023559 transcript:ENSPANT00000015203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISCRAKFKMSEILVLGLLLATPSCLAYSEDLANCFQDPDYESFLVTAQEGLHTSPLPKCV
VVVGPGMSGLVAAKTLQDAGHHVTILEASDHIGGRVVTFRNEEEGWYYDLGPMSIPKSHS
LVYTYVKKFGLKLNKFIQHDDNTWYLIKVRYRSWEVKANPDLLGYSVSPTEKGKSAMNLF
YESIDKVPSALPHLKMFNCSHLMSFYDSYSTKVSEAKKPQNGSKARGPRSASHPHCPIHP
CSFFKVTGGFDQLPKALSASLKPGTLHLRSKVEAVVRDGPQVQVSYRADLPAWAQCTLTA
DYVVVSASAKAMCLIAFQPPPSTDKIDTLRSVHYTGTTKMVLACDQRFWEWDGCIPMGIR
GGVSITDQPSRYIIYPSRSLPDGKGVLLASYTLDDDSLFFTALKHDQVVDIVLNNLATVH
QIPKEELWRMCPSSVVKKWSLDSLAMGTFADFTPYQFVHYWEQLSQPEGRIHFTGEHTGL
PHGWMDTAVKTGLRAARNIQAAVDQEAMVGQGQK
Download sequence
Identical sequences ENSPANP00000005632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]