SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005659 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005659
Domain Number 1 Region: 9-153
Classification Level Classification E-value
Superfamily L domain-like 5.95e-26
Family U2A'-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005659   Gene: ENSPANG00000016559   Transcript: ENSPANT00000001656
Sequence length 267
Comment pep:known_by_projection chromosome:PapAnu2.0:1:123980183:123998704:-1 gene:ENSPANG00000016559 transcript:ENSPANT00000001656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMKKKINLELRNRAPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMANVELSSLARL
PSLNKLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDL
FNCEITNLEDYRESIFELLQQITYLDGFDQEDNEAPDSEEEDDEDGDEDDEEEEENEAGP
PEGYEEEEEEEEDEDEDEDEDEDEAGSELGEGEEEVGLSYLMKEEIQDEEDDDDYVEEGE
EEEEEEEEGLRGEKRKRDAEDDGEEDD
Download sequence
Identical sequences A0A096N087 A0A2K5J997 A0A2K5XRU9 A0A2K6DU37 A0A2K6P4F3 H9G093
XP_010385579.1.97406 XP_011767473.1.29376 XP_011793157.1.43180 XP_011829017.1.47321 XP_011886394.1.92194 ENSPANP00000005659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]