SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005681 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005681
Domain Number 1 Region: 93-186
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.46e-20
Family Ubiquitin-related 0.00000911
Further Details:      
 
Domain Number 2 Region: 492-566
Classification Level Classification E-value
Superfamily UBA-like 1.36e-19
Family UBA domain 0.0000909
Further Details:      
 
Domain Number 3 Region: 374-441
Classification Level Classification E-value
Superfamily UBA-like 0.000000000156
Family UBA domain 0.013
Further Details:      
 
Domain Number 4 Region: 458-496
Classification Level Classification E-value
Superfamily UBA-like 0.000000151
Family UBA domain 0.02
Further Details:      
 
Domain Number 5 Region: 260-413
Classification Level Classification E-value
Superfamily TPR-like 0.00000949
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005681   Gene: ENSPANG00000015941   Transcript: ENSPANT00000020248
Sequence length 662
Comment pep:known_by_projection chromosome:PapAnu2.0:3:172639128:172672179:1 gene:ENSPANG00000015941 transcript:ENSPANT00000020248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTNGGRRRIRALCWSQRAWRGAGMAQKKYLQAKLTQFLREDRIQLWKPPYTDENKKVGL
ALKDLAKKYSDKLECCENEVEKIIEEIRCKAIERGTGNENYRTTGIATIEVFLPPRLKKD
RKNLLETRLLITGRELRSKIAETFGFQENYIKIVINKKQLQLGKTLEEQGVAHNVKAMVL
ELKQSEEDVRKNFQLEEEEQNEAELKEKQIQRTKRGLEILAQRAAETVVDPEMTPYLDIA
NQTGRSIRIPASERKALMLAMGYHEKGRAFLKRKEYGIALPCLLDADKYFCECCRELLDT
VDNYAVLQLDIVWCYFRLEQLECLDDAEKKLNLAQKCFKNCYGENHQRLVHIKGNCGKEK
VLFLRLYLLQGIRNYHSGNDVEACEYLNKARQLLKELYIDPSKVDNLLQLGFTAQEARLG
LRACDGNVDHAATHITNRREELAQIRKEEKEKKRRRLENIRSLKGMGYSTHAAQQALHAA
SGNLDEALKILLSNPQMWWLNDSNPETDNRQESPSQENIDQLVYMGFDALVAEAALRVFR
GNVQLAAQTLAHNGGSLPPDLPLSPEDSLSPPATSPSDSAGTSSASTDEDMETEAVNEIL
EDIPEHEEDYLDSTLEDEEMIIAECAPSGGSFQPQDCSSSQMPSGLSSRCIQDFSSLPEG
TD
Download sequence
Identical sequences ENSPANP00000005681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]