SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005714 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005714
Domain Number 1 Region: 366-427
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000797
Family Myb/SANT domain 0.0091
Further Details:      
 
Domain Number 2 Region: 489-550
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000128
Family Erythroid transcription factor GATA-1 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005714   Gene: ENSPANG00000018378   Transcript: ENSPANT00000000229
Sequence length 1500
Comment pep:known_by_projection chromosome:PapAnu2.0:1:11193389:11491192:-1 gene:ENSPANG00000018378 transcript:ENSPANT00000000229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RERTEEGTWRIMTADKDNSRPRRSCTLEGGAKNYAESDHSEDEDNDNNSATAEESTKKNK
KKPPKKKSRYERTDTGEITSYITEDDVVYRPGDCVYIESRRPNTPYFICSIQDFKLVHNS
QACCRSPTPALCDPPACSLPVASQPPQHLSEAGRGPVGSKRDHLLMNVKWYYRQSEVPDS
VYQHLVQDRHNENDSGRELVITDPVIKNRELFISDYVDTYHAAALSRGKCNISHFSDIFA
AREFKARVDSFFYILGYNPETRRLNSTQGEIRVGPSHQAKLPDLQPFPSPDGDTVTHHEE
LVWMPGVNDCDLLMYLRAARRSMAAFAGMCDGGSTEDGCVAASRDDTTLNALNTLHESGY
DAGKALQRLVKKPVPKLIEKCWTEDEVKRFVKGLRQYGKNFFRIRKELLPNKETGELITF
YYYWKKTPEAASSRAHRRHRRQAVFRRIKTRTASTPVNTPSRPPSSEFLDLSSASEDDFD
SEDSEQELKGYACRHCFTTTSKDWHHGGRENILLCTDCRIHFKKYGELPPIEKPVDPPPF
MFKPVKEEDDGLSGKHSMRTRRSRGSMSTLRSGRKKQPASPDGRTSPINEDIRSSGRNSP
SAASTSSNDSKAETVKKSAKKVKEEASSPLKSTKRQREKVASDTEEADRTSSKKTKTQEI
SRPNSPSEGEGESSDSRSVNDEGSSDPKDIDQDNRSTSPSIPSPQDNESDSDSSAQQQML
QAQPPALQAPTGVTPAPSSAPPGTPQLPAPGPMPSATAVPPQGSPTASQAPNQPQAPTAP
VPHTHIQQAPALHPQRPPSPHPPPHPSPHPPLQPLTGSAGQPSAPSHAQPTLHGQGPPGP
HSLQTGPLLQPLGTSPAAAHPHTSLQLPASQSALQSQQPPREQPLPPAPLAMPHIKPPPT
TPIPQLPAPQAHKHPPHLSGPSPFSMNANLPPPPALKPLSSLSTHHPPSAHPPPLQLMPQ
SQPLPSSLAQHPFVPGGPPPITPPTCPSTSTPPAGPGTSAQPPCSAAVASGGSIAGGSSC
PLPTVQIKEEALDDTEEPESPPPPPRSPSPEPTVVDTPSHASQSARFYKHLDRGYNSCAR
TDLYFMPLAGSKLAKKREEAIEKAKREAEQKAREEREREKEKEKEREREREREREAERAA
KASSSAHEGRLSDPQLSGPGHMRPSFEPPPTTIAAVPPYIGPDTPALRTLSEYARPHVMS
PTNRNHPFYMPLNPTDPLLAYHMPGLYNVDPTIRERELREREIREREIRERELRERMKPG
FEVKPPELDPLHPAANPMEHFARHSALTIPPTAGPHPFASFHPGLNPLERERLALAGPQL
RPEMSYPDRLAAERIHAERMASLTSDPLARLQMFNVTPHHHQHSHIHSHLHLHQQDPLHQ
GSAGPVHPLVDPLTAGPHLARFPYPPGTLPNPLLGQPPHEHEMLRHPVFGTPYPRDLPGA
IPPPMSAAHQLQAMHAQSAELQRLAMEQQWLHGHPHMHGGHLPSQEDYYSRLKKEGDKQL
Download sequence
Identical sequences ENSPANP00000005714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]