SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005715 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005715
Domain Number 1 Region: 933-1202
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.27e-71
Family Tandem AAA-ATPase domain 0.0000319
Further Details:      
 
Domain Number 2 Region: 673-931
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.92e-55
Family Tandem AAA-ATPase domain 0.000049
Further Details:      
 
Domain Number 3 Region: 431-481,509-552
Classification Level Classification E-value
Superfamily Chromo domain-like 2.33e-17
Family Chromo domain 0.021
Further Details:      
 
Domain Number 4 Region: 572-643
Classification Level Classification E-value
Superfamily Chromo domain-like 2.95e-17
Family Chromo domain 0.0044
Further Details:      
 
Domain Number 5 Region: 316-389
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.86e-17
Family PHD domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000005715
Domain Number - Region: 158-197
Classification Level Classification E-value
Superfamily HMG-box 0.000449
Family HMG-box 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005715   Gene: ENSPANG00000006765   Transcript: ENSPANT00000016146
Sequence length 1951
Comment pep:known_by_projection chromosome:PapAnu2.0:1:8944367:9024050:-1 gene:ENSPANG00000006765 transcript:ENSPANT00000016146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGPLGTEEELPRLFAEEMENEDEMSEEEDGGLEGFDDFFPVEPVSLPKKKKPKKLKENK
CKGKRKKKEGSNDELSENEEDLEEKSESEGSDYSPNKKKKKKLKEKKEKKAKRKKKDEDE
DDNDDGCLKEPKSSGQLMAEWGLDDVDYLFSEEDYHTLTNYKAFSQFLRPLIAKKNPKIP
MSKMMTVLGAKWREFSANNPFKGSSAAAAAAAVAAAVETVTISPPLAVSPPQVPQPVLIR
KAKTKEGKGPGVRKKIKGSKDGKKKGKGKKMAGLKFRFGGISNKRKKGSSSEEDEREESD
FDSASIHSASVRSECSAALGKKSKRRRKKKRIDDGDGYETDHQDYCEVCQQGGEIILCDT
CPRAYHLVCLDPELEKAPEGKWSCPHCEKEGIQWEPKDDDDEEEEGGCEEEEDDHMEFCR
VCKDGGELLCCDACPSSYHLHCLNPPLPEIPNGEWLCPRCTCPPLKGKVQRILHWRWTEP
PAPFMVGLPGPDVEPSLPPPKPLEGIPEREFFVKWAGLSYWHCSWVKELQLELYHTVMYR
NYQRKNDMDEPPPFDYGSGDEDGKSEKRKNKDPLYAKMEERFYRYGIKPEWMMIHRILNH
SFDKKGDVHYLIKWKDLPYDQCTWEIDDIDIPYYDNLKQAYWGHRELMLGEDTRLPKRLL
KKGKKLRDDKQEKPPDTPIVDPTVKFDKQPWYIDSTGGTLHPYQLEGLNWLRFSWAQGTD
TILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPDFYVVTY
TGDKESRSVIRENEFSFEDNAIRSGKKVFRMKKEVQIKFHVLLTSYELITIDQAILGSIE
WACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNN
LEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYY
KFILTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGSSLV
KSSGKLMLLQKMLKKLRDEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQ
EAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQN
KKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSGSMTKQELDDILKFGTEEL
FKDDVEGMMSQGQRPVTPIPDVQSSKGGNLAASAKKKHGSTPPGDNKDVEDSSVIHYDDA
AISKLLDRNQDATDDTELQNMNEYLSSFKVAQYVVREEDGVEEVEREIIKQEENVDPDYW
EKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDED
EDFEERPEGQSGRRQSRRQLKSDRDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRWG
MPPQDAFNSHWLVRDLRGKSEKEFRAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHV
LTRIGVMSLVRKKVQEFEHVNGKYSTPDLIPEGPEGKKPGEVISSDPNTPVPASPAHLPP
APLSLPDKMEAQLGYMDEKDPGMQKPKKPLEVQALPAALDRVEGEDKHESPASKERAREE
RPEETEKAPPSPEQLPREEVLPEKEKVLDKLELSLIHSRGDGSELRPDDTKAEEKEPIET
QQNGDKEEDDEGKKEDKKGKFKFMFNIADGGFTELHTLWQNEERAAVSSGKIYDIWHRRH
DYWLLAGIVTHGYARWQDIQNDPRYMILNEPFKSEIHKGNYLEMKNKFLARRFKLLEQAL
VIEEQLRRAAYLNMTQDPNHPAMALNARLAEVECLAESHQHLSKESLAGNKPANAVLHKV
LNQLEELLSDMKADVTRLPSMLSRIPPVAARLQMSERSILSRLTNRAGDPTIQQISSRPR
DFPVLQRSFPAEPRLPGHMPDPHGREKLPPF
Download sequence
Identical sequences ENSPANP00000005715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]