SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005735 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005735
Domain Number 1 Region: 182-271
Classification Level Classification E-value
Superfamily TPR-like 0.0000000335
Family Tetratricopeptide repeat (TPR) 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000005735
Domain Number - Region: 341-467
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.0201
Family AlkB-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005735   Gene: ENSPANG00000009047   Transcript: ENSPANT00000017947
Sequence length 614
Comment pep:known_by_projection chromosome:PapAnu2.0:14:64134592:64171393:-1 gene:ENSPANG00000009047 transcript:ENSPANT00000017947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGARLAALLAVLALGTGNPERAAARGDTFSALTSVARALGPERRLLGLLRRYLRGEEA
RLRDLTRFYDKVLSLHEDSTTPVANPLLAFTLIKRLQSDWRNVVHSLEASENIRALKDGY
EKVEQDLPAFEDLEGAARALMRLQDVYMLNVKGLARGVFQRVTGSAITDLYSPKRLFSLT
GDDCFQVGKVAYDMGDYYHAIPWLEEAVSLFRGSYGEWKTEDEASLEDALDHLAFAYFQA
GNVSCALSLSREFLLYSPDNKRMARNVLKYERLAESPNQVVAEAVIQRPNEGLCQTLGSQ
PTLYQIPSLYCSYETNSNAYLLLQPIRKEVIHLEPYIALYHDFVSDSEAQKIREFAEPWL
QRSVVASGEKQLQVEYRISKSAWLKDTVDPMLVTLNHRIAALTGLDVRPPYAEYLQVVNY
GIGGHYEPHFDHATSPSSPLYRMKSGNRVATFMIYLSSVEAGGATAFIYANLSVPVVKHC
FGGTCIGVVKGTVTHFMRAVLSWWEISGWPTSGYMSMDRNSADPAAPALKTELLSERSWW
SPVAFQRSQEPKAGVGEEKAEQPPAGRPCQLCLCLANQRQGRGRYQGTQNVRLICSSHGS
QSRMHSTKERGVEA
Download sequence
Identical sequences ENSPANP00000005735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]