SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005746 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005746
Domain Number 1 Region: 47-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000115
Family EGF-type module 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005746   Gene: ENSPANG00000005388   Transcript: ENSPANT00000007367
Sequence length 133
Comment pep:known_by_projection chromosome:PapAnu2.0:5:54590660:54595275:-1 gene:ENSPANG00000005388 transcript:ENSPANT00000007367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALEVPISVYLLFNAMTALTEEAAVTVTPPITAQQADNVEGPIALKFSHLCLEDHNSYCI
NGACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYEKYIAIGIGVGLLLSGFLVIF
YCYIRKRYEKDKI
Download sequence
Identical sequences XP_011821539.1.47321 ENSPANP00000005746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]