SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005775 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005775
Domain Number 1 Region: 1324-1663
Classification Level Classification E-value
Superfamily NHL repeat 5.23e-23
Family NHL repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 1633-1817
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000602
Family All0351-like 0.066
Further Details:      
 
Domain Number 3 Region: 1019-1090
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000647
Family Pre-dockerin domain 0.079
Further Details:      
 
Domain Number 4 Region: 728-753
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000434
Family EGF-type module 0.044
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000005775
Domain Number - Region: 858-883
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000236
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 761-787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 828-852
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000914
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 894-929
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0016
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 694-721
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00487
Family Integrin beta EGF-like domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005775   Gene: ENSPANG00000004552   Transcript: ENSPANT00000005300
Sequence length 2864
Comment pep:known_by_projection chromosome:PapAnu2.0:14:68543440:69343949:-1 gene:ENSPANG00000004552 transcript:ENSPANT00000005300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPDHSALSAARTLFVDVEECGPEAMDVKERKPYRSLTRRRDAERRYTSSSADSEEGKTP
QKSYSSSETLKAYDQDARLAYGSRVKDMVPQEAEEFCRTGANFTLRELGLGEVTSPHGTL
YRTDIGLPHCGYSMGASSDADMEADTVLSPEHPVRLWGRSTRSGRSSCLSSRANSNLTLT
DTEHENTETGAPLHCSSASSTPIEQSPSPPPSPPANESQRRLLGNGVAQPTPDSDSEEEF
VPNSFLVKSGSASLGVAANDHPGGLQNHARLRTPPPPLSHTHTPNQHHAASINSLNRGNF
TPRSNPSPAPTDHSLSGEPPASGAQEPAHAQDNWLLNSNIPLETRNLGKQPFLGTLQDNL
IEMDILGASRHDGAYGDGHFLFKPGGTSPLFCTTSPGYPLTSSTVYSPPPRPLPRSTFAR
PAFNLKKPSKYCNWKCAALSAIVISATLVILLAYFVAMHLFGLNWHLQPMEGQMYEITED
TASSWPVPTDVSLYPSGGTGLETPDRKGKGTAEGKPSSFFPEDSFIDSGEIDVGRRASQK
IPPGTFWRSQVFIDHPVHLKFNVSLGKAALVGIYGRKGLPPSHTQFDFVELLDGRRLLTQ
EARSLEGTPRQSRGAVPPSSHETGFIQYLDSGIWHLAFYNDGKESEVVSFLTTAIESVDN
CPSNCYGNGDCISGTCHCFLGFLGPDCGRASCPVLCSGNGQYMKGRCLCHSGWKGAECDV
PTNQCIDVACSNHGTCIMGTCICNPGYKGESCEEVDCMDPTCSGRGVCVRGECHCSVGWG
GTNCETPRATCLDQCSGHGTFLPDTGLCSCDPSWTGHDCSIEICAADCGGHGVCVGGTCR
CEDGWMGAACDQRACHPRCAEHGTCRDGKCECSPGWNGEHCTIAHYLDRVVKEGCPGLCN
GNGRCTLDLNGWHCVCQLGWRGAGCDTSMETACGDSKDNDGDGLVDCMDPDCCLQPLCHV
NPLCLGSPDPLDIIQETQVPVSQQNLHSFYDRIKFLVGRDSTHIIPGENPFDGGHACVIR
GQVMTSDGTPLVGVNISFVNNPIFGYTISRQDGSFDLVTNGGISIILRFERAPFITQEHT
LWLPWDRFFVMETIIMRHEENEIPSCDLSNFARPNPVVSPSPLTSFASSCAEKGPIVPEI
QALQEEISIAGCKMRLSYLSSRTPGYKSVLRISLTHPTIPFNLMKVHLMVAVEGRLFRKW
FAAAPDLSYYFIWDKTDVYNQKVFGLSEAFVSVGYEYESCPDLILWEKRTAVLQGYEIDA
SKLGGWSLDKHHALNIQSGILHKGNGENQFVSQQPPVIGSIMGNGRRRSISCPSCNGLAD
GNKLLAPVALTCGSDGSLYVGDFNYIRRIFPSGNVTNILELRNKDFRHSHSPAHKYYLTT
DPMSGAVFLSDTNSRRVFKIKSTVVVKDLVKNSEVVAGTGDQCLPFDDTRCGDGGKATEA
TLTNPRGITVDKFGLIYFVDGTMIRRIDQNGIISTLLGSNDLTSARPLSCDSVMDISQVR
LEWPTDLAINPMDNSLYVLDNNVVLQISENHQVRIVAGRPMHCQVPGIDHFLLSKVAIHA
TLESATALAVSHNGVLYIAETDEKKINRIRQVTTSGEISLVAGAPSGCDCKNDANCDCFS
GDDGYAKDAKLNTPSSLAVCADGELYVADLGNIRIRFIRKNKPFLNTQNMYELSSPIDQE
LYLFDTTGKHLYTQSLPTGDYLYNFTYTGDGDVTLITDNNGNMVNVRRDSTGMPLWLVVP
DGQVYWVTMGTNSALKSVTTQGHELAMMTYHGNSGLLATKSNENGWTTFYEYDSFGRLTN
VTFPTGQVSSFRSDTDSSVHVQVETSSKDDVTITTNLSASGAFYTLLQDQVRNSYYIGAD
GSLRLLLANGMEVALQTEPHLLAGTVNPTVGKRNVTLPIDNGLNLVEWRQRKEQARGQVT
VFGRRLRVHNRNLLSLDFDRVTRTEKIYDDHRKFTLRILYDQAGRPSLWSPSSRLNGVNV
TYSPGGHIAGIQRGIMSERMEYDQAGRIISRIFADGKTWSYTYLEKSMVLLLHSQRQYIF
EFDKNDRLSSVTMPNVARQTLETIRSVGYYRNIYQPPEGNASVIQDFTEDGHLLHTFYLG
TGRRVIYKYGKLSKLAETLYDTTKVSFTYDETAGMLKTINLQNEGFTCTIRYRQIGPLID
RQIFRFTEEGMVNARFDYNYDNSFRVTSMQAVINETPLPIDLYRYDDVSGKTEQFGKFGV
IYYDINQIITTAVMTHTKHFDAYGRMKEVQYEIFRSLMYWMTVQYDNMGRVVKKELKVGP
YANTTRYSYEYDADGQLQTVSINDKPLWRYSYDLNGNLHLLSPGNSARLTPLRYDLRDRI
TRLGDVQYKMDEDGFLRQRGGDIFEYNSAGLLIKAYNRAGGWSVRYRYDGLGRRVSSKSS
HSHHLQFFYADLTNPTKVTHLYNHSSSEITSLYYDLQGHLFAMELSSGDEFYIACDNIGT
PLAVFSGTGLMIKQILYTAYGEIYMDTNPNFQIIIGYHGGLYDPLTKLVHMGRRDYDVLA
GRWTSPDHELWQHLSSSNIMPFNLYMFKNNNPISNSQDIKCFMTDVNSWLLTFGFQLHNV
IPGYPKPDMDAMEPSYELIHTQMKTQEWDNSKSILGVQCEVQKQLKAFVTLERFDQLYGS
TITSCQQAPKTKKFASSGSIFGKGVKFALKDGRVTTDIISVANEDGRRVAAILNNAHYLE
NLHFTIDGVDTHYFVKPGPSEGDLAILGLSGGRRTLENGINVTVSQINTVLNGRTRRYTD
IQLQYGALCLNTRYGTTLDEEKARVLELARQRAVRQAWAREQQRLREGEEGLRAWTEGEK
QQVLSTGRVQGYDGFFVISVEQYPELSDSANNIHFMRQSEMGRR
Download sequence
Identical sequences ENSPANP00000005775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]