SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005863 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005863
Domain Number 1 Region: 42-159
Classification Level Classification E-value
Superfamily C-type lectin-like 5.6e-29
Family C-type lectin domain 0.000000534
Further Details:      
 
Domain Number 2 Region: 262-328
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000126
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 3 Region: 565-630
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000334
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 317-383
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000347
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 5 Region: 200-267
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000361
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 503-569
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000445
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 7 Region: 441-507
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000139
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 8 Region: 378-445
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 9 Region: 642-707
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000584
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 10 Region: 697-762
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000208
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 11 Region: 162-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000192
Family EGF-type module 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005863   Gene: ENSPANG00000011947   Transcript: ENSPANT00000005805
Sequence length 830
Comment pep:known_by_projection chromosome:PapAnu2.0:1:192487481:192529986:-1 gene:ENSPANG00000011947 transcript:ENSPANT00000005805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCQKAISYQRFQRAVFGIARLLCFSALISELTNQKEVAAWTYHYSTKAYSWNTSRKYC
QNRYTDLVAIQNKKEIDYLNEVLPYYSTYYWIGIRKSNKTWTWVGTKKALTKEAENWADN
EPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGN
YTCSCYPGFYGPECEYVTECGELELPQHVLMNCSHPLGNFSFNSQCSFHCADGYQVNGPS
KLECLASGIWTHKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCGFSCEEGFALVG
PEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCIHPLAAFAYGSNCKFECQLGYRV
RGLDTLRCIGSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRTFQYDTNCSFRCAEGF
MLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEAQVNCSHPFGAFRYQSVCSFTCNE
DLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCHFNC
DEGFSLSGPERLDCTRSGRWTDSPPTCEAIKCPELFAPEQGSLDCSDTHRGFNVGSTCHF
SCNKGFKLEGPNNVKCTTSGRWSATPPACKGIASLPSPGVQCPALTTPGQGTMHCRHHPG
TFGFNTTCYFGCNAGFTLIGDSILSCRPSGQWTAVTPTCRAVKCPELHVNKPIVMNCSNL
WGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTMPTCQAGPLTIQEALTYFGGAVA
STTGLIMGGTLLALLRKRFRQKDDGKCPLNPHSHLGTYGVFTNAAFDPSS
Download sequence
Identical sequences A0A096N0S4
ENSPANP00000005863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]