SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005866 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005866
Domain Number 1 Region: 644-754
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000000177
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 
Domain Number 2 Region: 374-495
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000427
Family Regulator of G-protein signaling, RGS 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000005866
Domain Number - Region: 877-982
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00014
Family Regulator of G-protein signaling, RGS 0.013
Further Details:      
 
Domain Number - Region: 86-196
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00387
Family Regulator of G-protein signaling, RGS 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005866   Gene: ENSPANG00000009564   Transcript: ENSPANT00000025055
Sequence length 1076
Comment pep:known_by_projection chromosome:PapAnu2.0:1:181731680:181824199:-1 gene:ENSPANG00000009564 transcript:ENSPANT00000025055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLHVEIIGSTNLIILLEDEIFADFFNTFLSLPVFGQTPFYTVENSQWSLWPEIPCNLIAK
YKGLLTWLEKHRLPFFCKTNLCFHYILCQELISFIKSPEGGEELVDFWILAEKILSIDEM
DLEVRDYYLSLLLMLRATHLQEGSRVVTLCNMNIKSLLSISIWHPNQSTTRREILSHMQK
VALFKLQSYWLPNFYTHTKMTMAKEEACHGLMQEYETRLYSVCYTHVGGLPLNMSIQKCH
HSHKQYSSRKAKRKMWQLVDPDSWSLEMDLKPDTIGTPLQETCPQEKVIIQMPFLKMASS
KETRISSLEKDMHYAKKSSMKNKAKSHLHMEGLFETKVSTHLRTVTPIIHHSSKMTIQKA
IKQSFSLGYIHLALCADSYAGNPFRDHLKKLNLKVEIQLLDLWQDLHHFLSVLVNNKNNG
NAIFRHLLGDRICELYLNEQIGPRLPLKSQTIQGLKELLPSGDVIPWIPKAQKEICKMLS
PWYDEFLDEEDYWFLLFTTQNKFISSRQHKREFIGKEENILLYKRIQHSLELSQALADMK
EMDYMQWRKIATEDLKQGGSLQVELTSPVFLTDVTKMSFEELCYKNPKIAVEKISDDYKV
YCEKAPKIAFKVEIIKEPKIFSRSNRKMSFLKKALVRKPSMRPRNLTEVLLNTQHLEFFR
EFLKERKAESPLQFLIAVQKISMETSEKICKSLIENVIKTFFQGQLSPEEMLQCDAPIIK
EITPTRHVTTTTLLILQGYIMKSIEEKWFKDYQDLFPPRPEEVEVQSEVQVSSRKPSKIV
STYLQESQKKGWLRMISFIRSFCKYRRFMLNPNKRQEFEDYLRQEMQNSKENFTTSHNTS
GRSAPPSTNVRSADQENGDTTLVKRRVFGHRIITVNFVINDLYFFSEMEKFNNLVSSAHM
LQVNRAYNENDVILMRSKMNIIQKLFLNSDIPPKLRVNVSESQKDAILAAITEGYLDRSV
FHGAIMSVFPVIMYFWKRFCFWKATRSYLQYRGKKFKDRKSPPKSTEKYPFSSGGDNAIL
RFTLLRGIEWLQPQREAISSVQNSSSSNLTQPRLVVSALQLHPVQGQKLSYTKKEK
Download sequence
Identical sequences ENSPANP00000005866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]