SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005875 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005875
Domain Number 1 Region: 23-424,658-805
Classification Level Classification E-value
Superfamily TPR-like 1.33e-112
Family Tetratricopeptide repeat (TPR) 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005875   Gene: ENSPANG00000011201   Transcript: ENSPANT00000009941
Sequence length 1019
Comment pep:known_by_projection chromosome:PapAnu2.0:1:130136388:130169307:-1 gene:ENSPANG00000011201 transcript:ENSPANT00000009941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKTAYQEVFKPENISLRNKLR
ELCVKLMFLHPVDYGRKAEELLWRKVYYEVIQLIKTMKFQSQHIHSRSTLECAYRTHLVA
GIGFYQHLLLYIQSHYQLELQCCIDWTHVTDPLIGCKKPVSASGKEMDWAQMACHRCLVY
LGDLSRYQNELAGVDTELLAERFYYQALSVAPQIGMPFNQLGTLAGSKYYNVEAMYCYLR
CIQSEVSFEGAYGNLKRLYDKAAKMYHQLKKCETRKLSPGKKRCKDIKRLLVNFMYLQSL
LQPKSSSMDSELTSLCQSVLEDFNLCLFYLPSSPNLSLASEDEEEYESGYAFLPDLLIFQ
MVIICLMCVHSLERAGSKQYSAAIAFTLALFSHLVNHVNIRLQAELEEGENPVPAFQSDG
TDEPESKEPLEKEEEPDPEPPPIVPQVGEGRKSRKFSRLSCLRRRRHPPKAGDDSDLSEG
FESDSSHDSARASEGSDSGSDKSLEGGGTAFDAETDSEMNSQESRSDLEDMEEEEGTRSP
TLEPPQGRSEAPDSLNGPLGPSEASIASNLQAMSTQMFQTKRCFRLAPTFSNLLLQPTTD
PHTSASHRPCVNGDVDKPSEPGSSLGSESEGSESSGRSCRNERSIQEKLQVLMAEGLLPA
VKVFLDWLRTNPDLIIVCAQSSQSLWNRLSVLLNLLPAAGELQESGLALCPEVQDLLEGC
ELPDLPSSLLLPEDMALRNLPPLRAAHRRFNFDTDRPLLSTLEESVVRICCIRSFGHFIA
RLQGSILQFNPEVGIFVSIAQSEQESLLQQAQAQFRMAQEEARRNRLMRDMAQLRLQLEV
SQLEGSLQQPKAQSAMSPYLVPDTQALCHHLPVIRQLATSGRFIVIIPRTVIDGLDLLKK
EHPGARDGIRYLEAEFKKGNRYIRCQKEVGKSFERHKLKRQDADAWTLYKILDSCKQLTL
AQGAGEEDPSGMVTIITGLPLDNPSVLSGPMQAALQAAAHASVDIKNVLDFYKQWKEIG
Download sequence
Identical sequences ENSPANP00000005875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]