SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005904 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000005904
Domain Number - Region: 13-42
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0186
Family CCCH zinc finger 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005904   Gene: ENSPANG00000024746   Transcript: ENSPANT00000017502
Sequence length 285
Comment pep:known_by_projection chromosome:PapAnu2.0:2:133473653:133631592:-1 gene:ENSPANG00000024746 transcript:ENSPANT00000017502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGR
CSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSV
APSLATNASAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDR
LEGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMT
PATSVVPMVHGATPATVSAATTSATSVPFAATATANQYISNAGNS
Download sequence
Identical sequences A0A096N0W4
ENSPANP00000005904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]