SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005908 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005908
Domain Number 1 Region: 45-171
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.13e-43
Family Single strand DNA-binding domain, SSB 0.000000351
Further Details:      
 
Domain Number 2 Region: 203-269
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.45e-20
Family C-terminal domain of RPA32 0.0000348
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005908   Gene: ENSPANG00000017991   Transcript: ENSPANT00000025597
Sequence length 270
Comment pep:known_by_projection chromosome:PapAnu2.0:1:30111680:30132816:-1 gene:ENSPANG00000017991 transcript:ENSPANT00000025597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLV
DEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVV
PPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGR
APISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVS
SIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
Download sequence
Identical sequences P15927
NP_002937.1.87134 NP_002937.1.92137 gi|4506585|ref|NP_002937.1| ENSPANP00000005908 2pi2A ENSP00000363021 9606.ENSP00000363021 2pi2_A 2pi2_B 2pi2_C 2pi2_D 2z6k_A 2z6k_B ENSP00000363021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]