SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005936 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005936
Domain Number 1 Region: 669-942
Classification Level Classification E-value
Superfamily SAICAR synthase-like 8.17e-94
Family Inositol polyphosphate kinase (IPK) 0.00000000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005936   Gene: ENSPANG00000014076   Transcript: ENSPANT00000027030
Sequence length 947
Comment pep:known_by_projection chromosome:PapAnu2.0:1:138545468:138649002:1 gene:ENSPANG00000014076 transcript:ENSPANT00000027030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVYCYALNSLVIMNSANEMKSGGGPGPSGSETPPPPGKAVLSPGSVFSPGRGASFLFPP
VQSLSPEEPRSPGGWRSGRRRLNSSSGSGSGSGSGSGSSVSSPSWAGRLRGDGQQVVAAG
TLSPPGPEEAKRKLRILQRELQNVQVNQKVGMFEAHIQAQSSAIQAPRSPRLGRARSPSP
CPLRSSSQPPGRVLVQGARIEERRTKSWGEQCPETSGADSRRKGGPGLCTSQVKEGMPPL
PGRGAPTGSEAWGPFVRMEKGISASPRCDSPTAMEIDKRVSPPPGTRSCLAPSLGLVGAS
LTMATEVAAKATPTGPHRPQDLALTEPSGRARELEDPQPREALVERQGQFLGSETSPAPE
RGGPRAGEPPGNMGKGNLPCGMPGSGAPEVGERPEETTVSVQSAESSDALSWSRLPRALA
SVGPEEARSGAPVGRGRWQLPDRVEGGSPTLGLLGGSPSAQPGTPDVEAGIPSGRMLEPL
PCWDTAKDLKEPQCPPGDRVGVQPGSSRVWQGTMEEVGLAWTCGTGVQSEGTWESQRQDR
DAHPSPELLPQDQDKPFLREACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLS
SSSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQKPRVSKSWRKIKNMVHWSP
FVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMVDVLRPFVPAYHGDV
VKDGERYNQMDDLLADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMYQKMIEVDPE
APTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGTVNRDFKKTKTREQVTEA
FREFTKGNHNILIAYRDRLKAIRTTLEVSPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFG
KTTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLIDILTEMSQDAPLA
Download sequence
Identical sequences A0A096N0Z5
ENSPANP00000005936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]