SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005983 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005983
Domain Number 1 Region: 3154-3328
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.57e-32
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 2983-3146
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.33e-29
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 3 Region: 2755-2924
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.59e-21
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 4 Region: 2585-2756
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-20
Family Laminin G-like module 0.0038
Further Details:      
 
Domain Number 5 Region: 2383-2574
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000158
Family Laminin G-like module 0.03
Further Details:      
 
Domain Number 6 Region: 1351-1402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000156
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 7 Region: 1682-1724
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family Laminin-type module 0.0061
Further Details:      
 
Domain Number 8 Region: 1261-1309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family Laminin-type module 0.0081
Further Details:      
 
Domain Number 9 Region: 526-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.008
Further Details:      
 
Domain Number 10 Region: 1734-1784
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000381
Family Laminin-type module 0.048
Further Details:      
 
Domain Number 11 Region: 346-418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000725
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 12 Region: 481-528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000977
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 13 Region: 289-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000184
Family Laminin-type module 0.054
Further Details:      
 
Domain Number 14 Region: 1400-1448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000273
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 15 Region: 626-676
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 16 Region: 416-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000977
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 17 Region: 679-720
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000279
Family Laminin-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000005983
Domain Number - Region: 1647-1684
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00248
Family Laminin-type module 0.042
Further Details:      
 
Domain Number - Region: 94-174
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00312
Family APC10-like 0.06
Further Details:      
 
Domain Number - Region: 1313-1348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00377
Family Laminin-type module 0.032
Further Details:      
 
Domain Number - Region: 2210-2310
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00562
Family Apolipoprotein A-I 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005983   Gene: ENSPANG00000006011   Transcript: ENSPANT00000024691
Sequence length 3329
Comment pep:known_by_projection chromosome:PapAnu2.0:18:15770539:16043357:1 gene:ENSPANG00000006011 transcript:ENSPANT00000024691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAARPRGRAPGPVLPPTPAWGATARDPRAAAGLSLHPPYFNLAEAARIWATATCGERG
PSERRPRPELYCKLVGGPTAPGSGHTIQGQFCDYCNSEDPRKAHPVTNAIDGSERWWQSP
PLSSGTQYNRVNLTLDLGQLFHVAYILIKFANSPRPDLWVLERSVDFGSTYSPWQYFAHS
KVDCLKEFGQEANMAVTRDDDVLCVTEYSRIVPLENGEVVVSLINGRPGAKNFTFSHTLR
EFTKATNIRLRFLRTNTLLGHLISKAQRDPTVTRRYYYSIKDISIGGRCVCNGHAEVCNA
NNPEKLFRCQCQHHTCGETCDRCCTGYNQRRWRPAAWEQSHECEACNCHGHASDCYYDSD
VERQQASLNTQGIYAGGGVCINCQHNTAGVNCEQCAKGYYRPYGVPVDAPDGCIPCSCDP
EHADGCEQGSGRCHCKPNFHGDNCEKCAAGYYNFPFCLKIPIFPVSTPSPEDPVAGDVRG
CDCNLEGVLPEICDAHGRCLCRPGVEGPRCDTCRSGFYSFPICQACWCSALGSYQMPCSS
VTGQCECRPGVTGQRCDRCLSGAYDFPHCQGSSSACDPAGTIDSNLFNSYCSHKCRLHTV
EIPTCSICKPLYWNLDKENPNGCSECQCHKAGTVSGTGECRQGDGDCHCKSHVGGDSCDT
CEDGYFALEKSNYFGCQGCQCDIGGALSSVCSGPSGVCQCREHVVGKACQRPENNYYFPD
LHHMKYEIEDGSTPNGRDLRFGFDPLAFPGFSWRGYAQMTSVQNDVRITLNVGKSSGSLF
HVILRYINPGTEAVSGHITIYPSWGAAQSKEIIFLPSKEPAFVTVPGNGFADPFSITPGI
WIACIKAEGVLLDYLVLLPRDYYEASVLQLPVTEPCAYAGPPQENCLLYQHLPVTRFPCT
LACEARHFLLDGEPRPVAVRQPTPAHPVMVDLSGREVELHLRLRVPQVGRYVVVLEYSTE
AAQLFVADVNVKSPRSVLAGQVNIYSCKYSVLCRSAVIDHMSRIAVYELLADADIQLKGH
MARFLLHQVCIIPIEEFSAEYVRPQVHCIASYRRFVNQSATCVSLAHETPPTALILDVVS
GRPFPHLPQQSSPSVDVLPGVTLKAPQNQVTLRGRAPHPGRYVFVIHFYQAAHPTFPAQM
SVDGGWPRAGSFRASFCPHVLGCRDQVIAEGQIEFDISEPEVAATVKVPEGKSLVLVRVL
MVPTENYDYQILHKKSMDKSLEFITNCGKNSFYIDPQTASRFCKNSARSLVAFYHKGALP
CECHPAGATSPHCSPEGGQCPCRPNVIGRQCTRCATGHYGFPHCKPCSCGLRLCEEMTGQ
CRCPPRTVRPQCEVCETHSFSFHPMAGCEGCNCSRRGTSEAAMLECDRDSGQCRCKPRIT
GRQCDRCASGFYRFPECVPCNCNRDGTEPGVCDPGTGACLCKENVEGTECNVCREGSFHL
DPANPKGCTSCFCFGVNNQCHSSHKRRAKFVDMLGWRLETADRMDIPVSFNPGSNSMVAD
LQELPATVHSASWVAPASYLGDKVSSYGGYLTYQAKSFGLPSDMVLLEKKPDVQLTGQHM
SVIYEETNTPRPDRLHHGRVQVVEGNFRHASSRAPVSREELMTVLSRLADMRIQGLYFTE
TQRLTLSEVGLEEASDTGSGRIAYAVEMCACPPAYTGDSCQGCSPGYYRDHKGLYTGRCV
PCNCNGHSNRCQDGSGICVNCQHNTAGEHCERCQEGYYGNAVHGSCRACPCPHTNRFATG
CVVNGGDVRCSCKAGYTGTQCERCAPGYFGNPQKFGGSCQPCSCNNNGQLGSCDPLTGDC
INQEPKDSSPAEECDDCDSCVMTLLNDLATMGEQLHLVKSQLQGLSASAGLLEQMRHMET
QAKDLRNQLLNYRSTISNHGSKIEGLERELTDLNQEFETLQEKAQVNSRKAQTLYNNVNR
AIQSAKELDMKIKTVIRNVHILLKQISGPDGEGNNVPSGDFSREWAEAQRMMRELRNRNF
GKHLREAEADKRESQLLLNRIRTWQKAHQGENNGLANSIRDSLNEYETKLSDLRARLQEA
AARAKQANGLNQENERALGAIQQRQVKEINSLQSDFTKYLTSADSSLLQTNIALQLMEKS
QKEYEKLAASLNEARQELSDKVRELSRSAGKTSLVEEAEKHAQSLQELAKQLEEIKRNAS
GDELVRCAVDAATAYENILNAIKAAEDAANRAASASESALQTVIKEDLPRKAKTLSTNSD
KLLNEAKMTQKKLKQEVSPALSNLQQTLNIVTVQREVIATNLTTLRDGLRGIQRGDTDAM
ISSAKSMVRKANDITDEVLDGLNPIQTDVERIKDTYGSTQNEDFKKALTDADNSVNKLTN
KLPDLWRKIESINQQLLPLGNISDNMDRIRELIQQARDAASKVAVPMRFNGKSGVEVRLP
NDLEDLKGYTSLSLFLQRPNSRENGGTENMFVMYLGNKDASRDYIGMAVVDGQLTCVYNL
GDGETELQVDQILTESETQEAVMDRVKFQRIYQFARLNYTKGATSSKPEIPGVYDMDGRN
SNTLLNLDPENVVFYVGGYPPDFKLPSRLRFPPYKGCIELDDLNENVLSLYNFKKTFNLN
TTEVEPCRRRKEESDKNYFEGTGYARVPTQPHASIPTFGQTIQTTVDRGLLFFAENGDRF
ISLNIDDGKLMVRYKLNSEPPKERGVGDTINNGRDHSIQIKIGKVQKRMWINVDFQNTII
DGEVFDFSTYYLGGIPIAIRERFNISTPAFRGCMKNLKKTSGVVRLNDTVGVTKKCSEDW
KLVRSASFSRGGQLSFTNLGSPLTDHLQASFGFQTFQPSGILLSHQTWTSTLQVTLEDGH
IELSTRDSGGPIFKSPQTYMDGLLHYVSVISDNSGLRLLIDDQPLRNNQRPNRISSSQQS
LRLGGSNFEGCISNVFVQRLSLSPEVLDLASNSLKRDVSLGGCSLNKPPFLMLLQGSTRF
NKAKTFRINQLLQDTPVASPRSMKVWQDACSPLPRTQANHGALQFGDIPTSHLLFKLPQE
LLKPRSQFAVDVQTTSSRGLVFHTGTKNSFMALYLSKGRLVFALGTDGKKLRIKSKEKCN
DGKWHTVVFGHDGEKGRLVVDGLRAREGSLPGNSTVSIRGPVYLGSPPSGKPKSLPTNSF
VGCLKNFQLDSKPLDTPSSSFGVSSCLGGPLEKGIYFSEEGGHVILAHSVLLGPEFKLVF
SIRPRSLTGILIHIGSQPGKHLCVYLEAGKVTASMDSGAGGTSTSVTPKQSLCDGQWHSV
AVTIKQHVLHLELDTDSSYTAGQTPFPPASTQEPLHLGGAPANLSTLRIPVWKSFFGCLR
NIFVNHIPVPVTEALEVQGPVSLNGCPDH
Download sequence
Identical sequences ENSPANP00000005983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]