SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005987 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005987
Domain Number 1 Region: 217-365
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.86e-42
Family Dual specificity phosphatase-like 0.000000454
Further Details:      
 
Domain Number 2 Region: 29-167
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.96e-24
Family Cell cycle control phosphatase, catalytic domain 0.00000948
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005987   Gene: ENSPANG00000018303   Transcript: ENSPANT00000022271
Sequence length 398
Comment pep:known_by_projection chromosome:PapAnu2.0:2:83227188:83236074:1 gene:ENSPANG00000018303 transcript:ENSPANT00000022271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GARGGSEPGAGSGSGAGTGAGAATGAGAMPCKSAEWLQEELEVRGGASLLLLDCRPHELF
ESSHIETAINLAIPGLMLRRLRKGNLPIRSIIPNHADKERFATRCKAATVLLYDEATAEW
QPEPGAPASVLGLLLQKLRDDGCQAYYLQDTGGFNKFQTEYSEHCETNVDSSSSPSSSPP
TSVLGLGGLRISSDCSDGESDRELPSSATESDGSPVPSSQPAFPVQILPYLYLGCAKDST
NLDVLGKYGIKYILNVTPNLPNAFEHGGEFTYKQIPISDHWSQNLSQFFPEAISFIDEAR
SKKCGVLVHCLAGISRSVTVTVAYLMQKMNLSLNDAYDFVKRKKSNISPNFNFMGQLLDF
ERTLGLSSPCDNHAPSEQLYFSTPTNHNLFPLNTLEST
Download sequence
Identical sequences ENSPANP00000005987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]