SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006001 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006001
Domain Number 1 Region: 4-195
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.6e-54
Family G proteins 0.0000000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006001   Gene: ENSPANG00000010758   Transcript: ENSPANT00000002292
Sequence length 211
Comment pep:known_by_projection chromosome:PapAnu2.0:3:38769970:38797087:1 gene:ENSPANG00000010758 transcript:ENSPANT00000002292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTVGETYGKDITSRGKDKPIADVFLICFSLVSPASFENVRAKWYPEV
RHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALT
QRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
Download sequence
Identical sequences A0A096N159 A0A2I2YGX5 A0A2K5LH80 A0A2K6D5T6 A0A2K6FTA9 A0A2K6RLE8 A4D2P0 H2PLF7 H2R207 H9ZBW3 U3BVZ6
ENSGGOP00000018145 ENSPPYP00000019439 ENSPANP00000006001 ENSP00000348461 ENSGGOP00000026185 ENSP00000348461 ENSP00000348461 ENSPPYP00000019439 ENSPTRP00000043196 ENSPTRP00000043196 gi|9845509|ref|NP_061485.1| NP_061485.1.87134 NP_061485.1.92137 XP_008016921.1.81039 XP_009450811.1.37143 XP_011767808.1.29376 XP_011912411.1.92194 XP_012494440.1.63892 XP_014988754.1.72884 XP_016801496.1.37143 XP_019278115.1.44245 XP_020137056.1.48125 9598.ENSPTRP00000043196 9600.ENSPPYP00000019439 9606.ENSP00000348461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]