SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006017 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006017
Domain Number 1 Region: 7-138
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.49e-21
Family APC10-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006017   Gene: ENSPANG00000017708   Transcript: ENSPANT00000021004
Sequence length 140
Comment pep:known_by_projection chromosome:PapAnu2.0:19:17770364:17771494:-1 gene:ENSPANG00000017708 transcript:ENSPANT00000021004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVS
QLQIQFQGGFSSRRGCLEEGSQGSQALRKIADFYPEDNNSLQTFPIPAAEVDRLKVTFED
ATDFFGRVVIYHLRVLGEKV
Download sequence
Identical sequences ENSPANP00000006017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]