SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006021 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006021
Domain Number 1 Region: 409-861
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.14e-129
Family PIWI domain 0.0031
Further Details:      
 
Domain Number 2 Region: 114-435
Classification Level Classification E-value
Superfamily PAZ domain 6.12e-88
Family PAZ domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006021   Gene: ENSPANG00000003836   Transcript: ENSPANT00000000656
Sequence length 861
Comment pep:known_by_projection chromosome:PapAnu2.0:11:129531672:129565852:1 gene:ENSPANG00000003836 transcript:ENSPANT00000000656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGRARARARGRARGQETVPLVGSTASQQPGYIQPRSQQPPAEGELFGRGRQRGTVGGTA
KSQELQISAGFQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFR
LTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTE
VFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPNDPID
IPSHRLVIWPGFTTSILQYENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVS
KELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQP
VLVSQPKRRRGPGGTLPGPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQRE
VGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSK
ETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMKKAIMIEVDDRTEA
YLRVLQQKVTTDTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAI
ATKIALQMNCKMGGELWRVDIPLKLAMIVGIDCYHDTTAGRRSIAGFVASINEGMTRWFS
RCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQF
LDCLKSIGRGYNPRLTVIVVKKRVNARFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIV
SQAVRSGSVSPTHYNVIYDNSGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAF
LVGQSIHREPNLSLSNRLYYL
Download sequence
Identical sequences A0A096N174 A0A2K5M4Z5 A0A2K5Z5K0 A0A2K6E924 E1AWN5 G8F4S6
NP_001182640.1.72884 XP_011754554.1.29376 XP_011754555.1.29376 XP_011754556.1.29376 XP_011754557.1.29376 XP_011754558.1.29376 XP_011837335.1.47321 XP_011926868.1.92194 XP_011926869.1.92194 XP_011926870.1.92194 XP_015287314.1.63531 ENSPANP00000006021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]