SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006027 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006027
Domain Number 1 Region: 32-131
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.56e-26
Family PDI-like 0.0078
Further Details:      
 
Domain Number 2 Region: 262-347
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000332
Family PDI-like 0.07
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000006027
Domain Number - Region: 141-228
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0663
Family Calsequestrin 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006027   Gene: ENSPANG00000012139   Transcript: ENSPANT00000004158
Sequence length 456
Comment pep:known_by_projection chromosome:PapAnu2.0:18:60978348:61019363:-1 gene:ENSPANG00000012139 transcript:ENSPANT00000004158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAWRSWAALRLCATVVLLDMVVCKGFVEDLDESFKENRNDDIWLVDNKFYAPWCGHCKK
LEPIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRT
KDDIIEFAHRVSGALIRPLPSQQMFEHMQKRHRVFFVYIGGESPLKEKYIDAASELIVYT
YFFSASEEVVPEYVTLKEMPAVLVFKDETYFVYDEYEDGDLSSWINRERFQNYLAMDGFL
LYELGDTGKLVALAVIDEKNTSVEHARLKSIIQEVARDYRDLFHRDFQFGHMDGNDYINT
LLMDELTVPTVVVLNTSNQQYFLLDRQIKNVEDMVQFINNILDGTVEAQGGDSILQRLKR
IVFDAKSTIVSIFKSSPLMGCFLFGLPLGVISIMCYGIYTADTDGGYIEERYEVSKSENE
NQEQIEESKEQQEPSSGESVVPTVQEPKDVLEKKKD
Download sequence
Identical sequences ENSPANP00000006027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]