SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006043 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006043
Domain Number 1 Region: 405-528
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 7.06e-59
Family alpha-catenin/vinculin 0.00000053
Further Details:      
 
Domain Number 2 Region: 570-759
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.77e-56
Family alpha-catenin/vinculin 0.00024
Further Details:      
 
Domain Number 3 Region: 1-157
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.02e-51
Family alpha-catenin/vinculin 0.0000000882
Further Details:      
 
Domain Number 4 Region: 274-403
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.35e-47
Family alpha-catenin/vinculin 0.000000432
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006043   Gene: ENSPANG00000010409   Transcript: ENSPANT00000005148
Sequence length 803
Comment pep:known_by_projection chromosome:PapAnu2.0:6:132335631:132486785:1 gene:ENSPANG00000010409 transcript:ENSPANT00000005148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTAAGEFADDPCSSVKRGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILK
LRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYT
ASQACLQHPDVAAYKANRDLIYKQLQQAVTGISNAAQATASDDASQHQGGGGGELAYALN
NFDKQIIVDPLSFSEERFRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQA
LQDLLSEYMGNAGRKERSDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLV
LIEAAKNGNEKEVKEYAQVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQ
VINAALALAAKPQSKLAQENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDV
NKCVIALQEKDVDGLDRTAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTV
MPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDF
ETEDFDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVS
KWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDRLGRTI
ANHCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAK
NLMNAVVQTVKASYVASTKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIK
RASQKKHVNPVQALSEFKAMDSI
Download sequence
Identical sequences ENSPANP00000006043 XP_011852633.1.47321 XP_011945811.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]