SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006045 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006045
Domain Number 1 Region: 4-448,560-606
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.99e-81
Family GDI-like N domain 0.00000000000319
Further Details:      
 
Domain Number 2 Region: 448-559
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 7.06e-42
Family GDI-like 0.00000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006045   Gene: ENSPANG00000016326   Transcript: ENSPANT00000027604
Sequence length 628
Comment pep:known_by_projection chromosome:PapAnu2.0:X:76094356:76272820:-1 gene:ENSPANG00000016326 transcript:ENSPANT00000027604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADTLPSEFDVIVIGTGLPESIIAAACSRSGRRVLHVDSRSYYGGNWASFSFSGLLSWLK
EHQENSDIENDSPVWQDQILENEEAIALSRKDKTIQHVEVFCYASQDLHEDVEEAGALQK
NHALVTSANSTEAADSSFLPMEDESLSTMNCEMLTEQTPSSDPENVLEVNGAEVTGEKEN
HCDDKTCVPSTSAEDMSENVPIAEDTTEQPKKNRITYSQIIKEGRRFNIDLVSKLLYSRG
LLIDLLIKSNVSRYAEFKNITRILAFREGRVEQVPCSRADVFNSKQLTMVEKRMLMKFLT
FCMEYEKYPDEYKGYEDITFYEYLKTQKLTPNLQYIVLHSIAMTSETASSTIDGLKATRN
FLHCLGRYGNTPFLFPLYGQGELPQCFCRMCAVFGGIYCLRHSVQCLVVDKESRKCKAII
DQFGQRIISEHFLVEDSYFSENMCSRVQYRQISRAVLITDRSVLKTDSDQQISILTVPAE
EPGTFAVRVIELCSSTMTCMKGTYLVHLTCTSSKTAREDLEPVVQKLFIPYTEMEIENEQ
VEKPRILWALYFNMRDSSDISRSCYKDLPSNVYVCSGPDCGLGNDNAVKQVRLLMFLSFV
LGCLCGWEIFFPLGGEKSLEKHLSIPFL
Download sequence
Identical sequences ENSPANP00000006045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]