SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006068 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006068
Domain Number 1 Region: 765-1042
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.13e-69
Family Protein kinases, catalytic subunit 0.00000724
Further Details:      
 
Domain Number 2 Region: 454-733
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-42
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 3 Region: 319-422,459-483
Classification Level Classification E-value
Superfamily SH2 domain 3.32e-17
Family SH2 domain 0.0036
Further Details:      
 
Domain Number 4 Region: 212-307
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000381
Family Third domain of FERM 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006068   Gene: ENSPANG00000004912   Transcript: ENSPANT00000026551
Sequence length 1069
Comment pep:known_by_projection chromosome:PapAnu2.0:19:16329687:16349525:-1 gene:ENSPANG00000004912 transcript:ENSPANT00000026551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPSPVGILPVYHSLFALATEDLSYWFPPSHIFSVEDASTQVLLYRIRFYFPNWFGLDKC
HRFGLRKDLASALLDLPVLEHLFAQHRSDLVSGRLAVGLSLKEQGECLSLAVLDLARMAR
EQAQRPGELLKTVSYKACLPPSLRDLIQGLSFVTRRRIRRTVRRALRRVAACQADRHSLM
AKYIMDLERLDPAGAAETFHVSLPGVPGGQDGLGMLRVAGDGGIAWTQGEQEVLQPFCDF
PEIVDISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGLPEALSFVALVDGYFRLTTDS
QHFFCKEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSRPGSYVLRRSPQDFDSFLLTV
CVQTPLGPDYKGCLIRRSPTGSFFLVGLSRSHSSLRELLAACWDGGLHVDGVTVTLTSCC
IPRPKEKSNLIVVQRGRSPPTSSLVQPQSQCQLSQMIFHKIPADSLEWHENLGHGSFTKI
YRGCRHEAVDGESRKTEVLLKVMDAKHKNCMESFLEAASLMSQVSYQHLVLLHGVCMAGD
STMVQEFVHLGAIDTYLRKRGHLVPASWKLQVVKQLAYALNYLEDKGLPHGNVSARKVLL
AREGTDGSPPFIKLSDPGVSPAVLSLEMLTDRIPWVAPECLRKAQTLSLEADKWGFGATV
WEVFSGVTMPISALDPAKKLQFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSFRAVIR
DLNSLISSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGS
VELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGR
QSLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNI
LVESEAHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGV
VLYELFTYCDKSCSPSAEFLRMMGCERDVPALCRLLELLEEGQRLPAPPACPAEVHELMK
LCWAPSPQDRPSFSTLGPQLDMLWSGSRGCETHAFTAHPEGKPHSLSFL
Download sequence
Identical sequences ENSPANP00000006068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]