SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006100 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006100
Domain Number 1 Region: 495-527,566-631
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000235
Family Anti-sigma factor antagonist SpoIIaa 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006100   Gene: ENSPANG00000010066   Transcript: ENSPANT00000012620
Sequence length 656
Comment pep:known_by_projection chromosome:PapAnu2.0:8:86767901:86915109:1 gene:ENSPANG00000010066 transcript:ENSPANT00000012620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGAKKKKKSMLWGKMHTPQCEDIIQWCRRRLPILDWAPHYNLKENLLPDTVSGIMLAVQ
QVTQGLAFAVLSSVHPVFGLYGSLFPAIIYAIFGMGRHVATGTFALTSLISANAVERIVP
QNIQNLTTPSNTSVMGLSDFEMQRIHVAVAVSFLGGVIQVAMFVLQLGSATFVVTEPVIS
AMTTGAATHVVTSQVKYLLGMKMPYISGPLGFFYIYAYVFENIKSVRLEALLLSLLSIVV
LVLVKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENTYGLEVVGHIPQGIPSPRAP
PMNILSAVITEAFGVALVGYVASLALAQGSAKKFKYSIDDNQEFLAHGLSNIVSSFFFCI
PSAAAMGRTAGLYSTGAKTQVACLISCIFVLIVIYAIGPLLYWLPMCVLASIIVVGLKGM
LIQFRDLKKYWNVDKIDWGIWVSTYVFTICFAANVGLLFGVVCTIAIVIGRFPRAMTLSI
KNMKEMEFKVKTEMDSETLQQVKIISINNPLVFLNAKKFYTDLMNIIQKENSCNQPLDDI
SKCEQNTLLNSLSNGNCNAEVSQSCPNEKCSLILDCSGFTFFDYSGVSMLVEVYMDCKGR
SVDVLLAHCTASLIKGMTYYGNLDSEKPIFFESVSAAISHIHSNKNLSKLSDHSEV
Download sequence
Identical sequences A0A096N1D2
ENSPANP00000006100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]