SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006150 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006150
Domain Number 1 Region: 4628-4786
Classification Level Classification E-value
Superfamily SET domain 2.09e-48
Family Histone lysine methyltransferases 0.0046
Further Details:      
 
Domain Number 2 Region: 934-995
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000288
Family PHD domain 0.0035
Further Details:      
 
Domain Number 3 Region: 324-378
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000699
Family PHD domain 0.0023
Further Details:      
 
Domain Number 4 Region: 884-942
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000102
Family PHD domain 0.019
Further Details:      
 
Domain Number 5 Region: 1008-1075
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000709
Family PHD domain 0.018
Further Details:      
 
Domain Number 6 Region: 264-326
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000288
Family PHD domain 0.013
Further Details:      
 
Domain Number 7 Region: 391-454
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000266
Family PHD domain 0.015
Further Details:      
 
Domain Number 8 Region: 1589-1636
Classification Level Classification E-value
Superfamily HMG-box 0.0000131
Family HMG-box 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006150   Gene: ENSPANG00000000719   Transcript: ENSPANT00000013052
Sequence length 4786
Comment pep:known_by_projection chromosome:PapAnu2.0:3:173407697:173701727:-1 gene:ENSPANG00000000719 transcript:ENSPANT00000013052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGLETTETETIVETAEIKEQSAEEDAEAEADNSKQLIPALQRSVSEESANSLVSVGVEA
KISEQLCAFCYCGEKSSLGQGDLKQFRVTPGFILPWRNQPSNKKDIDDNSNGTYEKMQNP
APRKQRGQRKKCCTVLYILPSLSPSPAFLPRRGKIFNFMSLLALIFLMCAHLLLFVFPIL
GTCWAHHRCVEWSLGVCQMEEPSLVNVDKAVVSGSTERCAFCKHLGATIKCCEEKCTQMY
HYPCAAGAGTFQDFSHIFLLCPEHIDQAPERSKEDANCAVCDSPGDLLDQFFCTTCGQHY
HGMCLDIAVTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVP
TNGWKCKNCRICIECGTRSSSQWHHNCLICDNCYQQQDNLCPFCGKCYHPELQKDMLHCN
MCKRWVHLECDKPTDHELDPQLKEEYICMYCKHLGAEMDPLQPGEEVEIAELTTDYNNEM
EVEGPEDQMVFPEHAVSKDVNDQESTPGIVPDAVQVHTEEQQKSHPSESLDTDSLLIAVS
SQHKMNTELEKQISNEVDSEEMKTSSEVKHICGEDQMEDKMEVTENIEVVTHQIIVQQEE
LQLLEEPKTVVSKEESGPPKLVIESVTLPLETLVSPHEGSISLCPEEQLVIERLQGEKEQ
KENSELSTGLVDSEMTPTIESCVKDVSYQGDKSIKFSSETESSFSSAADISKADVSSSPT
PSSDLPSHDMLHNYPSALSSSAGNIMPTTYISVTPKIGMGKPAITKRKFSPGRPRSKQGA
WSTHNTVSPPSWSPDISEGREIFKPRQLPGSAIWSIKVGRGSGFPGKRRPRGAGLSGRGG
RGRSKLKSGIGAVVLPGVSAADISSNKDDEENSMHNTVVLFSSSDKFTLNQDMCVVCGSF
GQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLECTVCEACGKATDPGRLLLCD
DCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGATSAGLRCEWQNNYTQCAPCASLSS
CPVCYRNYREEDLILQCRQCDRWMHAVCQNLNTEEEVENVADIGFDCSMCRPYMPASNVP
SSDCCESSLVAQIVTKVKELDPPKTYTQDGVCLTESGMTQLQSLTVTVPRRKRSKPKLKL
KIINQNSVAVLQTPPDIQSEHSRDGEMDDSREGELMDCDGKSESSPEREAVDDETKGVEG
TDGVKKRKRKPYRPGIGGFMVRQRSRTGQGKTKRSVIRKDSSGSISEQLPCRDDGWSEQL
PDTLVDESVSVTESTQLFTSKYSIRCNKETLGNFPVFMQEAFFGKDLLDTSRQSKISLDN
LSEDAAQLSYKTNMNAGFLDPSLDPLLSSSSAPAKSGTHGPADDPLADISEVLNTDDDIL
GIISDDLAKSVDHSDIGPVPDDPSLPQPSVNQSSRPLSEEQLDGILSPELDKMVTDGAIL
GKLYKIPELGGKDVEDLFTAVLSPANTQPTPLPQPPPPTQLLPIHNQDVFSRMPLMNGLI
GPSPHLPHNSLPPGSGLGTFSAIAQSPYPDARDKNSAFNPMASDPNNSWTSSAPTVEGEN
DTLSNAQRSTLKWEKEEALGEMATVAPVLYTNINFPNLKEEFPDWTTRVKQIAKLWRKAS
SQERAPYVQKARDNRAALRINKVQMSNDSMKRQQQQDSIDPSSRIDSELFKDPLKQRESE
HEQEWKFRQQMRQKSKQQAKIEATQKLEQVKNEQQQQQQQQFGSQHLLVQSGSDTPSSGI
QSPLTPQPGNGNMSPAQSFHKELFTKQPPSTPTSTSDDVFVKPQAPPPPPAPSRIPIQEG
LSQAQTSQPPSPQVFSPGSSNSRPPSPMDPYAKMVGTPRPPPVGHSFSRRNSAAPVENCT
PLSSVSRPLQMNETTANRPSPVRDLCSSSMTNNDPYAKPPDTPRPVMTDQFPKSLGLSRS
PIVSEQTAKGPVAAGTNDHFTKPSPRADVFQRQRIPDPYARPLLAPAPLDSGPGPFKTPM
QPPPSSQDPYGSVSQASRRLSVDPYERPALTPRPIDNFSHNQSNDPYSQPPLTPHPTMNE
SFAHPSRAFSQPGTISRPTSQDPYSQPPGTPRPVVDSYSQSSGTARSNTDPYSQPPGTPR
PATVDPYSQQPPTPRPSTQTDLFVTSVTNQRHSDPYAHPPGTPRPGISIPYSQPPATPRP
RISEGFTRSSMTRPVLIPNQDPFLQAAQNRGPALPGPLVRPPDTCSQTPRPPGPGLSDTF
SRVSPSAARDPYDQPPVTPRSQSDSFGTSQTAHDVADQPRPGSEGSFCASSNSPMHSQGQ
QFSGVSQLPGPVPTSGVTDTQNTVNMAQADTEKLRQRQKLREIILQQQQQKKIAGRQEKG
SQDSPAVPHPGPLQHWQPENINQAFARPPPPYPGNIRSPVAPPLGPRYAVFPKDQRGPYP
PDVASMGMRPHGFRRFGFPGGSHGTMPSQERXFSPQSLPVQQHNILGQAYIELRHRAPDG
RQRLPFSAPPGSVVEASSNLRHGNFIPRPEFPGPRHTEPMRRPPHGLPNQLPVHPDLEQV
PPSQQEQGHSVHSSSVVMRTLNHPLGGEFSEAPLSTSVPSETTSDNLQITTQPSDGLEEK
LDSDDPSVKELDVKDLEGVEVKDLDDEDLENLNLDTEDGKVVELDTLDNLETNDPNLDDL
LRSGEFDIIAYTDPELDLGDKKSMFNEELDLPIDDKLDNQCASVEPKEDKTLVLSDKHSP
QKKSTVTNEVKMEVLSPNSKVESKCETEKSDENKDNVDPPCSQASAHSDLNDGEKTSLHP
CDPDLFEKRTNRETADSSANVIQGSTQLPAQDVINSCGITGSTPVLSSLLANEKSDNSDI
RPLGSPPPTLPASPSNHVSSLPPLIAPPGHVLDNTVNSNVTVVSRVNHVFSQGVQVNPGF
IPGQSTVNHNLGTGKPTTQTGSLTSQSGTSSVSGPQQLMIPQTLAQQNRERPLLLEEQPL
LLQDLLDQERQEQQQQRQMQAMIRQRSEPFFPNIDFDAITDPIMKAKMVALKGINKVMAQ
NNLGMPPMVMSRFPFMGQAVTGTQNSEGQNLGPQAIPQDGSITHQISRPNPPNFGPGFVN
DSQRKQYEEWLQETQQLLQMQQKYLEEQIGAHRKSKKALSAKQRTAKKAGREFPEEDAEQ
LKHVTEQQSMVQKQLEQIRKQQKHAELIEDYRIKQQQQQQQCAMAPPTMMPSVQPQPPLI
PGATPPTMSQPSFPMVPQQLQHQQHTTVISGHTSPVRMPNLPGWQPNSASAHLPLNPPRI
QPPIAQLPIKTCTPAPGTVSNANPQSGPPPRVEFDDNNPFSESFQERERKERLREQQERQ
RIQLMQEVDRQRALQQRMEMEQHGMVGSEISSSRTSVSQIPFYSSDLPCDFMQPPRPLQQ
SPQHQQQMGQVLQQQNIQQGSINSPSTQTFMQTNERRQVGPPSFVPDSPSIPVGSPNFSS
VKQGHGNLSGTSFQQSPVRPSFTPALPAAPPVANSSLPCGQDSTITHGHSYPASTQSLIQ
LYSDIIPDDDAESTKAPSTPHSDITAPPTPSISETTSTPAVSTPSELPQQADQESVEPVG
PSTPSMAAGQLCTEVENKLPSSDFSQATPNQQTYANSEVDKLSMETPAKTEEIKLEKPET
ESCPGQEEPKLEEQSGSKVEGNAVACPVSSAQSPPHSVGAPAAKGDSGNELLKHLLKNKK
SSSLLNQKPEGNICSEDDCTKDNKLVEKQNPAEGLQTLGAQMQGGFGCGNQLPKTDGGSE
TKKQRSKRTQRTGEKAAPRSKKRKKDEEEKQAMYSSTDTFTHLKQQNNLSNPPTPPASLP
PTPPPMACQKMANGFATTEELAGKAGVLVSHEVTKTLGPKPFQLPFRPQDDLLARALAQG
PKTVDVPASLPTPPHNNQEELRIQDHCGDRDTPDSFVPSSSPESVVGVEVSRYPDLSLVK
EEPPEPVPSPIIPILPSTAGKSSESRRNDIKTEPGTLYFASPFRSSPNGPRSGLISVAIT
LHPTAAENISSVVAAFSDLLHVRIPNSYEVSNAPDVPSMGLVSSHRINPGLEYRQHLLLR
GPPPGSANPPRLVSSYRLKQPNVPFPPTSNGLSGYKDSSHGIAESTALRPQWCCHCKVVI
LGSGVRKSFKDLTLLNKDSRESTKRVEKDIVFCSNNCFILYSSTAQAKNSENKESIPSLP
QSPMRETPSKAFHQYSNNISTLDVHCLPQLQEKASPPASPPIAFPPAFEAAKVEAKPDEL
KVTVKLKPRLRTVHGGFEDCRPLNKKWRGMKWKKWSIHIVIPKGTFKPPCEDEIDEFLKK
LGTSLKPDPVPKDYRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAG
ALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCAIKAQCMFFKDKTMLCPM
HKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGSLIFHTIGQLLPQQ
MQAFHSPKALFPVGYEASRLYWSTRYANRRCRYLCSIEEKDGRPVFVIRIVEQGHEDLVL
SDISPKGVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACE
NYTFRYGRNPLMELPLAVNPTGCARSEPKMSAHVKRFVLRPHTLNSTSTSKSFQSTVTGE
LNAPYSKQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTII
RNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERG
HKIIISSNRRIQKGEELCYDYKFDFEDDQHKIPCHCGAVNCRKWMN
Download sequence
Identical sequences ENSPANP00000006150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]