SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006154 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006154
Domain Number 1 Region: 174-320
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6e-55
Family Single strand DNA-binding domain, SSB 0.0000000886
Further Details:      
 
Domain Number 2 Region: 58-170
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.46e-33
Family Single strand DNA-binding domain, SSB 0.0000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006154   Gene: ENSPANG00000020726   Transcript: ENSPANT00000028654
Sequence length 538
Comment pep:known_by_projection chromosome:PapAnu2.0:3:146940835:147047649:-1 gene:ENSPANG00000020726 transcript:ENSPANT00000028654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLELIKEVNGVPEVQPLSKLRKVDFGSLQPGYNYSKKYIQGKLSLISSLTYRGNKTAVL
QIGLQDYCSVVTIVDQTNVKLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQGI
TSSGFASLTFEGTLGAPIIPRTSSKYFNFTTEDHKMVETLRVWASTHMSPSWTLLKLCDV
QPMQYFDLTCQLLGKAEVDGASFLLKVWDGTRTPFPSWRVLIQDLVLEGDLSHIHRLQNL
TIDILVYDNHVHVARSLKVGSFLRIYSLHTKLQSMNSENQTMLSLEFHLHGGTSYGRGIR
VLPETNSDVDQLKKDLESANLTANQHSDVICQSEPDDSFPSSGSVSLYEVERCQQLSATI
LTDHQYLERTPLCAILKQKAPQQYRIRAKLRSYKPRRLFQSVKLHCPKCHLLQEVPREGD
LDIILQDGATKTPDVKLQNTALYDSKIWTTKNQKGRKVAVHFVKNNGILPLSNECLLLIE
GGTLSEICKLSNKFNSVIPVRSGHEDLELLDLSAPFLIQGTIHHYGCKQCSSLRSIQI
Download sequence
Identical sequences ENSPANP00000006154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]