SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006158 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006158
Domain Number 1 Region: 435-675,707-781
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.27e-58
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 5-99,130-157
Classification Level Classification E-value
Superfamily EF-hand 3.36e-41
Family EF-hand modules in multidomain proteins 0.0016
Further Details:      
 
Domain Number 3 Region: 131-222
Classification Level Classification E-value
Superfamily EF-hand 9.94e-22
Family Calmodulin-like 0.011
Further Details:      
 
Domain Number 4 Region: 227-296
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.82e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0031
Further Details:      
 
Domain Number 5 Region: 300-363
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000359
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006158   Gene: ENSPANG00000021188   Transcript: ENSPANT00000011069
Sequence length 803
Comment pep:known_by_projection chromosome:PapAnu2.0:3:95994951:96688889:1 gene:ENSPANG00000021188 transcript:ENSPANT00000011069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNQEKWAHLSPSEFSQLQKYAEYSTKKLKDVLEEFHGNGVLAKYNPEGKQDILNQTIDF
EGFKLFMKTFLEAELPDDFTAHLFMSFSNKFPHSSPMVKSKPALLSGGLRMNKGAITPPR
TTSPANSSSPEVIHLKDIVCYLSLLERGRPEDKLEFMFRLYDTDGNGFLDSSELENIISQ
MMHVAEYLEWDVTELNPILHEMMEEIDYDHDGTVSLEEWIQGGMTTIPLLVLLGLENNVK
DDGQHVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVK
SKKNADVMHHYWVEGNCPTKCDKCHKTVKCYQGLTGLHCVWCQITLHNKCASHLKPECDC
GPLKDHILPPTTICPVVLTLPTSGVSVPEDRQSTVKKEKSGSQQPNKVIDKNKMQRANSV
TVDGQGLQITPVPGTHPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLAGNGPMPGLN
FFRDVPDFRVLACGGDGTVGWVLDCIEKANVGKHPPVAILPLGTGNDLARCLRWGGGYEG
ENLMKILKDIENSTEIMLDRWKFEVIPNDKDEKGDPVPYSIINNYFSIGVDASIAHRFHI
MREKHPEKFNSRMKNKFWYFEFGTSETFSATCKKLHESVEIECDGVQIDLINISLEGIAI
LNIPSMHGGSNLWGESKKRRSHRRIEKKGSDKRTTVTDAKELKFASQDLSDQLLEVVGLE
GAMEMGQIYTGLKSAGRRLAQCSCVVIRTSKSLPMQIDGEPWMQTPCTIKITHKNQAPML
MGPPPKTGLFCSLVKRTRNRSKE
Download sequence
Identical sequences A0A096N1I6
ENSPANP00000006158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]