SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006167 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006167
Domain Number 1 Region: 120-318
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.93e-70
Family Arfaptin, Rac-binding fragment 0.0000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006167   Gene: ENSPANG00000008374   Transcript: ENSPANT00000007917
Sequence length 341
Comment pep:known_by_projection chromosome:PapAnu2.0:14:58504389:58511765:1 gene:ENSPANG00000008374 transcript:ENSPANT00000007917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGD
GLIPTGSGRHPSHSTTPAGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSR
TVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQE
EFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRT
DLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLL
FHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ
Download sequence
Identical sequences A0A096N1J3 A0A0D9QWC9 A0A1D5RK09 A0A2J8SVP2 A0A2K5E0V9 A0A2K5MCH1 A0A2K6DVQ6 A0A2K6M6X0 A0A2K6Q9P9 A0A2K6U316 F6ZCJ2 G1S6L2 G7PQV7
NP_001270205.1.63531 XP_002754993.1.60252 XP_002754994.3.60252 XP_003254906.2.23891 XP_003254907.1.23891 XP_003919825.2.74449 XP_008006812.1.81039 XP_008006820.1.81039 XP_010381835.1.97406 XP_010381836.1.97406 XP_011751300.1.29376 XP_011751301.1.29376 XP_011827885.1.47321 XP_011827886.1.47321 XP_011891835.1.92194 XP_011891836.1.92194 XP_012312181.1.9421 XP_014970459.1.72884 XP_014970460.1.72884 XP_015289593.1.63531 XP_017749126.1.44346 XP_017749127.1.44346 XP_017749128.1.44346 ENSNLEP00000021151 ENSMMUP00000010152 ENSCJAP00000025886 ENSMMUP00000010152 ENSPANP00000006167 9544.ENSMMUP00000010152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]