SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006186 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006186
Domain Number 1 Region: 503-643
Classification Level Classification E-value
Superfamily TPR-like 0.00000596
Family Tetratricopeptide repeat (TPR) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006186   Gene: ENSPANG00000007683   Transcript: ENSPANT00000027188
Sequence length 1442
Comment pep:known_by_projection chromosome:PapAnu2.0:18:23795790:23910872:-1 gene:ENSPANG00000007683 transcript:ENSPANT00000027188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQCVQSVQELIPDSFVPCVAALCSDEAERLTRLNHLSFAELLKPFSRLTSEVHMRDPNN
QLHVIKNLKIAVSNIVTQPPQPGAIRKLLNDVVSGSQPAEGLVANVITAGDYDLNISATT
PWFESYRETFLQSMPASDHEFLNHYLACMLVASSSEAEPVEQFSKLSQEQHRIQHNSDYS
YPKWFIPNTLKYYVLLHDVSAGNEQRAESIYEEMKQKYGTQGCYLLKINSRTSNRASDEQ
IPDPWSQYLQKNSIQNQESYEDGPCTMTSNKNSDNNLLSLDGLDNEVKDGLPNNFRAHPL
QLDQSSDPSNSIDGPHHARSASSLHETKKGNIGIIHGACLTLTDHDRIRQFIQEFTFRGL
LPHIEKTIRQLNDQLISRKGLSRSLFSATKKWFSGSKVPEKSINELKNTSGLLYPPEAPE
LQIRKMADLCFLVQHYDLAYSCYHTAKKDFLNDQAMLYAAGALEMAAVSAFLQPGAPRPY
PAHYMDTAIQTYRDICKNMVLAERCVLLSAELLKSQSKYSEAAALLIRLTSEQNTWKGMD
SDLRSALLLEQAAHCFINMKSPMVRKYAFHMILAGHRFSKAGQKKHALRCYCQAMQVYKG
KGWSLAEDHINFTIGRQSYTLRQLDNAVSAFRHILINESKQSAAQQGAFLREYLYVYKNV
SQLSPDGPLPQLPLPYINSSATRVFFGHDRRPADGEKQAATHVSLDQEYDSESSQQWREL
EEQVVSVVNKGVIPSNFHPTQYCLNSYSDNSRFPLAVVEEPITVEVAFRNPLKVPLLLTD
LSLLWKFHPKDFSEKDNEEVKQLVTSEPEMIGTEVISEFLINGEESKVARLKLFPHHIGE
LHILGVVYNLGTIQGSMTVDGIGALPGCHTGKYSLSMSVRGKQDLEIQGPRLNNTKEEKT
SVKYGPDRRLDPIITEEMPLLEVFFIHFPTGLLCGEIRKAYVEFVNVSKCPLTGLKVVSK
RPEFFTFGGNTAVLTPLSPSASENCSAYKTVVTDATSVCTALISSASSVDFGIGTGSQPE
VIPVPLPDTVLLPGASVQLPMWLRGPDEEGVHEINFLFYYESVKRQPKIRHRILRHTAII
CTSRSLNVRATVCRSNSLENEEGRGGNMLVFVDVENTNTSEAGVKEFHIVQVSSSSKHWK
LQKSVNLSENKDAKLASREKGKFCFKAIRCEKKEAATQSSEKYTFADIIFGNEQIISSAS
PCADFFYRSLSSELKKPQAHLPVHTEKQSTEDAVRLIQKCSEVDLNIVILWKAYVVEDSK
QLILEGQHHVILRTIGKEAFSYPQKQEPPEMELLKFFRPENTTVSSRPSVEQLSSLIKTS
LHYPESFNHPFHQKSLCLVPVTLLLSNCSKADVDVIVDLRHKTTSPEALEIHGSFTWLGQ
TQYKLQLKSQEIHSLQLKACFVHTGVYNLGTPRVFAKLSDQVTVFETSQQNSMPALIIIN
NV
Download sequence
Identical sequences ENSPANP00000006186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]