SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006209 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006209
Domain Number 1 Region: 79-217
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.27e-39
Family Glutathione S-transferase (GST), C-terminal domain 0.000000451
Further Details:      
 
Domain Number 2 Region: 2-75
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.78e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006209   Gene: ENSPANG00000004516   Transcript: ENSPANT00000010265
Sequence length 246
Comment pep:known_by_projection chromosome:PapAnu2.0:14:6489503:6501163:-1 gene:ENSPANG00000004516 transcript:ENSPANT00000010265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTMETWQEGSLKASCLYGQLPKFQDGD
LTLYQSNTFLRHLGRTLGLYGKDQREAALVDMVNDGVEDLRCKYLSLIYTNYEAGKDDYV
KALPGQLKPFETLLSHNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
VARLSARPKLKAFLASPEHVNLPINGNGKQFEEQGEPGAVTHACNPSTLGGRGRWITRSG
DRDHPG
Download sequence
Identical sequences A0A096N1N2
ENSPANP00000006209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]