SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006254 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000006254
Domain Number - Region: 9-139
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000218
Family Synaptotagmin-like (S variant) 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006254   Gene: ENSPANG00000004588   Transcript: ENSPANT00000008788
Sequence length 341
Comment pep:known_by_projection chromosome:PapAnu2.0:12:63391407:63451435:-1 gene:ENSPANG00000004588 transcript:ENSPANT00000008788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKKTLKGSDSEELEIKQETPNLVPFGDVVGCLGIHVKNCRHFTPNISLQHYANLFIRIS
INKAVKCTKMCSLLSKDSERNTVIKFDEVKYFSVQVPRRYDDERNNILLELIQYDNTEKR
AFLLGSVQVHLYEVIQKGCFIEEVQVLHRNVFVCRLEVEFMFSYGNFGYGFSHQLKPLQK
ITEPSMFMNPTPPPERTDPVTKVITPQTVEYPAFLSPDLNVTVGTPAVQSSDQISSVVRL
EKLQQQPRERLEKMKKEYRNLNTWIDKANYLESILMPKLEHKDSKETNVDEASENPKSNQ
SEEKLENVAGVADIPLVNEEAETTPNEVREIGRELLIVIIL
Download sequence
Identical sequences ENSPANP00000006254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]