SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006258 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006258
Domain Number 1 Region: 116-178
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000057
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 263-323
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000292
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 3 Region: 78-126
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000306
Family Complement control module/SCR domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006258   Gene: ENSPANG00000012053   Transcript: ENSPANT00000011467
Sequence length 465
Comment pep:known_by_projection chromosome:PapAnu2.0:X:90476358:90501160:1 gene:ENSPANG00000012053 transcript:ENSPANT00000011467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASQLTQRGALSLLFFLTPAVTPTWYAGSGYYPDESYNEVYAEEVPRAPALDYRVPRWCY
TLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQM
RCHALPFITSGTYTCTNGVLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDID
PPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIR
YTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGATCEYHCDGGYDRQG
TPSRVCQSSRQWSGSPPICTPMKINVNVNSAAGLLDQFYEKQRLLIISAPDPSNRYYKMQ
ISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVL
IDKQGIDRDRYMEPVTPEEIFTFIDDYLLSNQELTQRREQRDICE
Download sequence
Identical sequences A0A096N1S5 A0A2K6ARU8 A0A2K6QM54 A3FEK9 A3FEL0 G7Q378
ENSPANP00000006258 XP_005594168.1.63531 XP_005594169.1.63531 XP_010378480.1.97406 XP_011770113.1.29376 XP_011770114.1.29376 XP_011770115.1.29376 XP_011770116.1.29376 XP_014983281.1.72884 XP_014983282.1.72884 XP_014983283.1.72884 XP_015299564.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]