SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006301 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006301
Domain Number 1 Region: 116-185
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000123
Family HLH, helix-loop-helix DNA-binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006301   Gene: ENSPANG00000004064   Transcript: ENSPANT00000000952
Sequence length 193
Comment pep:known_by_projection chromosome:PapAnu2.0:13:16861830:16862408:1 gene:ENSPANG00000004064 transcript:ENSPANT00000000952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNLRETFLSLEDGLGSSDSPGLLSSWDWKDRAGPFELNQASPSQSLSPAPSLESYSSSP
CPVVTGLPCEHGGASSGGSDGCSVGGASGLVEVDYNMLAFQPAYLQGGGGPKAQKGTKVR
MSVQRRRKASEREKLRMRTLADALHTLRNYLPPVYSQRGQPLTKIQTLKYTIKYIGELTD
LLNRGREPRAQSA
Download sequence
Identical sequences A0A096N1W4 A0A0D9S9T3 A0A2K5HGG9 A0A2K5XK19 A0A2K6ASK8 A0A2K6KS59 A0A2K6NUL8 F7HGK2 G7PLN5
9544.ENSMMUP00000010659 XP_005576552.1.63531 XP_007969583.1.81039 XP_010353136.1.97406 XP_011736528.1.29376 XP_011806703.1.43180 XP_011826818.1.47321 XP_014967254.1.72884 XP_017726900.1.44346 ENSMMUP00000010659 ENSPANP00000006301 ENSMMUP00000010659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]