SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006318 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006318
Domain Number 1 Region: 45-130
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.71e-21
Family THAP domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006318   Gene: ENSPANG00000000281   Transcript: ENSPANT00000021072
Sequence length 283
Comment pep:known_by_projection chromosome:PapAnu2.0:1:9483918:9492457:1 gene:ENSPANG00000000281 transcript:ENSPANT00000021072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPWSRARPVTTSRRPRPSPQVPPLPAGPAAAIFVGGSRAWLEMPKSCAARQCCNRYSS
RRKQLTFHRFPFSRPELLKEWVLNIGRGNFQPKQHTVICSEHFRPECFSAFGNRKNLKHN
AVPTVFAFQDPTQQVRENTDPASERGNASSSQKEKVLPEAGAGEDSPGRKMDTALEELQL
PPNAEGPVKQVLPWRPQATEVVGRPAGPAGLRRPPSKQPSDHSYALLDLDSLKKKLFLTL
KENEKLRKRLQAQRLVMQRMSSRLRACKGHRGLQARLGPEQQS
Download sequence
Identical sequences ENSPANP00000006318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]