SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006336 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006336
Domain Number 1 Region: 931-1076
Classification Level Classification E-value
Superfamily Bromodomain 9.42e-27
Family Bromodomain 0.00052
Further Details:      
 
Domain Number 2 Region: 269-330
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.52e-16
Family B-box zinc-binding domain 0.0019
Further Details:      
 
Domain Number 3 Region: 869-926
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000115
Family PHD domain 0.0036
Further Details:      
 
Domain Number 4 Region: 124-191
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000261
Family RING finger domain, C3HC4 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006336   Gene: ENSPANG00000016076   Transcript: ENSPANT00000027924
Sequence length 1120
Comment pep:known_by_projection chromosome:PapAnu2.0:1:115217621:115334585:-1 gene:ENSPANG00000016076 transcript:ENSPANT00000027924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENKGGGEAESGGGGSGSAPVTAGAAGPAAQEAEPPLTAVLVEEEEEEGGRAGAEGGAA
GPDDGGVAAASSGSAQAASSPAASVGPAVPGGAVSTPAPAPASAPAPGPSAGPPPGPPAS
LLDTCAVCQQSLQSRREAEPKLLPCLHSFCLRCLPEPERQLSVPIPGGSNGDIQQVGVIR
CPVCRQECRQIDLVDNYFVKDTSEAPSSSDEKSEQVCTSCEDNASAVGFCVECGEWLCKT
CIEAHQRVKFTKDHLIRKKEDVSESVGASGQRPVFCPVHKQEQLKLFCETCDRLTCRDCQ
LLEHKEHRYQFLEEAFQNQKGAIENLLAKLLEKKNYVHFAATQVQNRIKEVNETNKRVEQ
EIKVAIFTLINEINKKGKSLLQQLENVTKERQMKLLQQQNDITGLSRQVKHVMNFTNWAI
ASGSSTALLYSKRLITFQLRHILKARCDPVPAANGAIRFHCDPTFWAKNVVNLGNLVIES
KPTPGYTPNVVVGQVPPGTNHISKTPGQINLAQLRLQHMQQQVYAQKHQQLQQMRMQQPP
APVPKHPRQAAPQMLQQQPPRLISVQTMQRGNMNCGAFQAHQMRLAQNAARIPGIPRHSG
PQYSMMQPHLQRQHSNPGHAGPFPVVSVHNTTINPTSPTTATMANANRGPTSPSVTAIEL
IPSVTNPENLPSLPDIPPIQLEDAGSSSLDNLLSRYISGSHLPPQPTSTMNPSPGPSALS
PGSSGLSNSHTPVRPPSTSSTGSRGSCGSSGRTAEKTSLSFKSDQVKVKQEPGTEDEICS
FSGGVKQEKTEDGRRSACMLSSPESSLTPPLSTNLHLESELDALASLENHVKTEPADMNE
SCKQSGLSSLVNGKSPIRSLMHRSARIGGDGNNKDDDPNEDWCAVCQNGGDLLCCEKCPK
VFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCE
RLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVAD
VRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA
PLPEFEQEEDDGEVTEDSDEDFIQPRRKRLKSDERPVHIK
Download sequence
Identical sequences ENSPANP00000006336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]