SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006358 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006358
Domain Number 1 Region: 141-337
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.51e-53
Family Reprolysin-like 0.00027
Further Details:      
 
Domain Number 2 Region: 356-432
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 4.18e-17
Family Blood coagulation inhibitor (disintegrin) 0.00044
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000006358
Domain Number - Region: 584-612
Classification Level Classification E-value
Superfamily EGF/Laminin 0.013
Family EGF-type module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006358   Gene: ENSPANG00000009844   Transcript: ENSPANT00000022042
Sequence length 674
Comment pep:known_by_projection chromosome:PapAnu2.0:8:37324007:37439768:1 gene:ENSPANG00000009844 transcript:ENSPANT00000022042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQISYIIPIDEKPYTVHLKQSFYISVNVYCFKYDQGSMNARSSDIQTQCYYQGNIEGYPD
SMVTLSTCSGLRGILQFENVSYAIEPLESAVEFQHVLYKLENEDNDIAIFSENNRSLEEH
PMDDNVSISEQSKPAVPDLFPLYLEMHIVVDKALYDYWGSDSMIVTNKVIEIVGLANSMF
AQFKVTIVLSSLEVWSDENKISTVGEADELLKRFLEWKQSYLNLRPHDIAYLLIYRDYPD
YMGATFPGKMCITRYSAGVALYPKEITLEAFSVIVTQMLALSLGISYDDPKKCRCSESIC
IMNPEALQSNGVKTFSSCSLRSFQNFISNVGAKCLQNKPQMQRKSPKPVCGNGRLEGSEM
CDCGTEAQCGPASCCDFRTCVLKDGAQCYRGSCCRDCQILQSGVECRPKAHPECDIAENC
NGSSPECGPDITLFNGLPCKNSKFICYDGDCHDLDARCESVFGKGSRNAPFACYEEIQSQ
ADRFGNCGRDRNNKYVFCGWRNLICGRLVCTYPTRKPFHQENGDVIYAFVRDSVCVTVDY
KLPRTVPDPLTVKNGSQCDVGRICVNRQCVESRKIKATALVCSEHICSGHGVCDSRQKCV
CSPGYNPPSCQTRSKGFPIFPKDSIMERASGKTENTWLLGFSIVLPILIVTTIVVLARKH
LKKWFIKEEEFPSS
Download sequence
Identical sequences ENSPANP00000006358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]