SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006402 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000006402
Domain Number - Region: 976-1047
Classification Level Classification E-value
Superfamily TPR-like 0.0303
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006402   Gene: ENSPANG00000020731   Transcript: ENSPANT00000012393
Sequence length 1461
Comment pep:known_by_projection chromosome:PapAnu2.0:13:42844664:42962332:-1 gene:ENSPANG00000020731 transcript:ENSPANT00000012393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSITLTPLFSEKCGFPSSNLKRSLAPPTFGAPCSWSLPRQATLRSRAPPVLLVERASSCG
DVRAMAALLRSSCWLLRAGAAPRLPLSLRLLTGGPGRPHAASYLPAARAGPVAGGLLSPA
RLYVIAAEKKDIQEESTFSSRRIANHFDWALMRLDNSVRRTGRIPKMLLQKVFDDTCRSG
GPGSSHALLLVRSCGSLLPELKPEERTEFAHRIWDKLQKLGAVYDVSHYNALLKVYLQNE
YKFSPTDFLAKMEEANIQPNRVTYQRLIASYCNMGDIEGASKILGFMKTKDLPVTEAVFS
ALVTGHARAGDMENAENILTVMREAGIEPGPDTYLALLNAYAEKGDIDHVKQTLEKVEKS
ELHLMDRDLFQIIFSFSKAGYPQYVSEILEKVTCERRYIPDAMNLILLLVTEKLEDVALQ
ILLSCPISKEDGISDFGSFFLRHCVTMNTPVEKLTDYCKKLKEIQMHSFPLQFTLHCALL
AKKTDLAKALMKAVKEEGFPIRTHYFWPLLVGHQKEKNVQGIIEVLKVMQELGVPPDQET
YIGYVIPCFNSIKSARAILQENGCLSNSDTFSQAELRSEAINGNLDFVLSFLESNTLPLS
LQSIRSSLLLGFRRSMNINLWSKITELLYKDGRYCPEPPGPTEAVGYFLYNLIDSMSDSE
VQAKEERLRQYFHQLKEMNVKIPENICRGIRNLLDSYHVPELIKDAYMLVDSENLDSQKT
VQLSSSELESRLETLKAEDQPIRDVLKHLILTLCSQENMQKALELKAKYESDMVISGYAA
LINLCCRHDNAEDALNLKEEFDRLDSSALLDTSKYVGLVRVLAKRGRLQDAINILKEMKK
KDVPIKDSTVLSFFHILNGAALRGEIETVKQLHEAIVTLGLAKPSTNISFPLVTVYLEKD
DPSTALDVAIDCCEKYKILPRMHDILCKLIEKGETDLIQKAMDFVSQEQGEMIMLYDLFF
AFLQTGNYKEAKKIIETPGIRARSTKLQWFCDKCVANNQVETLEKLVELTQKLFECDRDQ
MYYNLLKLYKMNGDWQRADAVWNKIQEENIIPREKTLRLLAEILRDGNQEVPFEVPELYE
DEKHSLNSSLDSSSDSTTELGFQKDILNACQWKQSKEAYGIFLKAKQQNVVFNAETYSDL
IKLLLSKGYFTQAVEVKAFAETHIKGFTLNDAANSLLIITQVRRDYLKEALTTLKTALDQ
QQIPSEIAVTRLIQALAMKGDVENIEVVQKMVNGLEDSIGLSKMVFINNTALAQIKNNNI
DVAIENIENMLTSENPGIEPQYFGLAYLFRKVIEEQLEPAVEKISIMAERLANQFAIYKP
VTDFFLQLVDAGKVDDARALLQRCGAIAEQTSILLVFFLRNSGKRGKASTLKSLLELIPE
LNEKEEAYSSLMKSYVSEKDVTSAKALYEHLTAKNTKLDDLFLKRYAVLLKNAGESVPFT
EPPESFEFYVQQVKELRENSS
Download sequence
Identical sequences A0A096N260
ENSPANP00000006402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]