SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006404 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006404
Domain Number 1 Region: 17-317
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.98e-35
Family WD40-repeat 0.0066
Further Details:      
 
Domain Number 2 Region: 246-307,334-501
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.0000000379
Family Tricorn protease domain 2 0.035
Further Details:      
 
Domain Number 3 Region: 1207-1320
Classification Level Classification E-value
Superfamily TPR-like 0.0000266
Family Tetratricopeptide repeat (TPR) 0.055
Further Details:      
 
Domain Number 4 Region: 860-1011
Classification Level Classification E-value
Superfamily ARM repeat 0.0000512
Family PBS lyase HEAT-like repeat 0.083
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000006404
Domain Number - Region: 1086-1268
Classification Level Classification E-value
Superfamily HCP-like 0.00017
Family HCP-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006404   Gene: ENSPANG00000022799   Transcript: ENSPANT00000027768
Sequence length 1693
Comment pep:known_by_projection chromosome:PapAnu2.0:13:26477308:26523420:-1 gene:ENSPANG00000022799 transcript:ENSPANT00000027768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLKHLRTLLSPQDGAAKVTCMAWSQNNAKFAVCTVDRVVLLYDEHGERRDKFSTKPADM
KYGRKSYMVKGMAFSPDSTKIAIGQTDNIIYVYKIGEDWGDKKVICNKFIQTSAVTCLQW
PAEYIIVFGLAEGKVRLANTKTNKSSTIYGTESYVVSLTTNCSGKGILSGHADGTIVRYF
FDDEGSGESQGKLVNHPCPPYALAWATNSIVAAGCDRKIVAYGKEGHMLQTFDYSRDPQE
REFTTAVASPGGQSVVLGSYDRLRVFNWSPQRSIWEEAKPKEIANLYTITALAWKRDGSR
LCVGTLCGGVEQFDCCLRRSIYKNKFELTYVGPSQVIVKNLSSGTRVVLKSHYGYEVEEV
KILGKERYLVAHTSDTLLLGDLNTNRLSEIAWQGSGGNEKYFFENENVCMIFNAGELTLV
EYGNNDTLGSVRTEFMNPHLISVRINERCQRGTEDNKKLAYLIDIKTIAIVDLIGGYNIG
TMSHESRVDWLELNETGHKLLFRDRKLRGDVIGLERGGGKTEVMVMEGVTTVAYTLDEGL
IEFGTAIDDGNYIRATAFLETLEMTPETEAMWKTLSKLALEARQLHIAERCFSALGQVAK
ARFLHETNEIADQVSREYGGEGTDFYQVRARLAMLEKNYKLAEMIFLEQNAVEEAMGMYQ
ELHRWDECIAVAEAKGHPALEKLRRSYYQWLMDTQQEERAGELQESQGDGLAAISLYLKA
GLPAKAARLVLTREELLANTELVEHITAALIKGELYERAGDLFEKIHNPQKALECYRKGN
AFMKAVELARLAFPVEVVKLEEAWGDHLVQQKQLDAAINHYIEARCSIKAIEAALGARQW
KKAIYILDLQDRNTASKYYPLVAQHYASLQEYEIAEELYTKGDRTKDAIDMYTQAGRWEQ
AHKLAMKCMRPEDVSVLYITQAQEMEKQGKYREAERLYVTVEEPDLAITMYKKHKLYDDM
IRLVGKHHPDLLSDTHLHLGKELEAEGRLQEAEYHYLEAQEWKATVNMYRASGLWEEAYR
VARTQGGANAHKHVAYLWAKSLGGEAAVRLLNKLGLLEAAVDHAADNCSFEFAFELSRLA
LKHKTPEVHLKYAMFLEDEGKFEEAEAEFIRAGKPKEAVLMFVHNQDWEAAQRVAEAHDP
DSVAEVLVGQARGALEEKDFQKAEGLLLRAQRPGLALNYYKEAGLWSDALRICKDYVPSQ
LEALQEEYEREATKKGARGVEGLVEQARHWEQAGEYSRAVDCYLKVRDSGNSGLAEKCWM
KAAELSIKFLPPQRNMEVVLAVGPQLIGIGKHSAAAELYLNLDLVKEAIDAFIEGEEWNK
AKRVAKELDPRYEDYVDQHYKEFLKNQGKVDSLVGVDVIAALDLYVEQGQWDKCIETATK
QNYKILHKYVALYATHLIREGNSAQALALYVQHGAPANPQNFNIYKRIFTDMVSSPGTNC
AEAYHSWADLRDVLFNLCENLVKSSEANSPAHEEFKTMLLIAHYYATRSAAQSVKQLETV
AARLSVSLLRHTQLLPVDKAFYEAGIAAKAVGWENMAFIFLNRFLDLTDAIEEGTLDGLD
HSDFQDTDIPFEVPLPAKQHVPEAEREEVRDWVLTVSMDQRLEQVLPRDERGAYEASLVA
ASTGVQALPCLITGYPILRNKIEFKRPGKAANKDNWNKFLMAIKTSHSPVCQDVLKFISQ
WCGGLPSTSFSFQ
Download sequence
Identical sequences ENSPANP00000006404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]