SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006407 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006407
Domain Number 1 Region: 4-85
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-19
Family SH3-domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000006407
Domain Number - Region: 493-563
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0455
Family alpha-catenin/vinculin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006407   Gene: ENSPANG00000016999   Transcript: ENSPANT00000006307
Sequence length 870
Comment pep:known_by_projection chromosome:PapAnu2.0:20:56947572:56985876:-1 gene:ENSPANG00000016999 transcript:ENSPANT00000006307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVPNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRL
KILVGMYDKKPAGPGPGPPTIPAQPQPGLHAPAPPASQYTPMLPTTYQPQPDSVYLVPTP
SKAQQGLYQAPGPSPQFQSPPAKQTSTFSKQTPHHQFPSPAADLYQVPPGPGGPAQDIYQ
VPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYDIPRHL
LAPGSQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPNGRDPLLEVYDVPPSVEKGLPLS
SHQAVYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPARTPLVLAVPPPDSPPAED
VYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEVADGGTVDNGVYAVPPPAEREA
PADGKRLSASSTGSTRSSQSASSLEVAGPGREPLELEVAVEALARLQQGVSTTVAHLLDL
AGSAGGTGSWRNPSEPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRTLHAK
LSRQLQKMEDVHQTLVAHGQALDAGRGGPGATPEDLDRLVACSRAVPEDAKQLASFLHGN
ASLLFRRTKAPAPGPEGGGTLHPNPTDKTSSIQSRPLPSPPKFTSQDSPDGQYENSEGGW
MEDYDYVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQLKQFERLEQEVSRPIDHDLA
NWTPAQPLAPGRTGGLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVA
HSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCNLLRGIVATTKAAALQYPSP
AAAQDMVERVKELGHSTQQFRRVLGQLAAA
Download sequence
Identical sequences A0A2I3MZ17
ENSPANP00000006407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]